BLENDER_v248REND 1 TITLE CARDGLOB  1  SRx SR2D Title Presets-Mode   ?}@eDATA  DATA   eDATA   @eDATA   @DATA  DATA 0 @DATA0 p KDATAp  0 @KDATA  p DATA 0 KDATA0 p DATAp  0 @DATA  p DATA 0 DATA0 p pDATAp  0 pDATA p pKDATA 8   DATA8    DATA  8  DATA   DATA X  DATAX    0 DATA  X  p DATA 0  0 p DATA0 x  0 DATAx  0 DATA  x 0 DATA P  DATAP   0 DATA  P 0 DATA (  p p DATA( p  p DATAp  ( DATA  p 0 DATA H  DATAH   0 DATA  H 0 DATA    p DATA  h  p p DATAh   0 p DATA  h p  DATA @  p  DATA@    DATA @ 0 p DATA L  ?@Pף@@@A8E J H` < (D DATA  PreviewLamp>DATA  LampLampF>DATA  SpotLamp>DATA  Texture and InputLamp>DATA  Map ToLamp> DATA (  PreviewMaterial>DATA( 8  MaterialMaterialF>DATA8 H ( PreviewWorld>DATAH X 8 WorldWorldF>DATAX h H Mist Stars PhysicsWorld>DATAh x X Texture and InputWorld>DATAx  h Map ToWorld>h DATA  x OutputRender>DATA   RenderRenderF>DATA   AnimRender>DATA   FormatRender>DATA   Link and MaterialsEditing>DATA   MeshEditingF>DATA   Mesh ToolsEditing>DATA   Mesh Tools 1Editing>DATA !  CameraEditingF>DATA! ("  ShadersMaterial>DATA(" 8# ! TextureMaterial>DATA8# H$ (" Anim settingsObject>DATAH$ X% 8# DrawObject>DATAX% h& H$ ConstraintsObject>DATAh& x' X% ScriptlinksScript>DATAx' ( h& EffectsObjectX% DATA( ) x' Map InputMaterial>(" DATA) * ( Map ToMaterial>(" DATA* + ) AnimAnim>DATA+ , * SoundSound>DATA, - + ListenerSoundF>DATA- . , SequencerSound>DATA. / - ArmatureEditingF>DATA/ 1 . RampsMaterialF>( DATA1 2 / Mirror TranspMaterial>! DATA2 (3 1 Mist / Stars / PhysicsWorld>DATA(3 84 2 Amb OccWorld>2 DATA84 H5 (3 Shadow and SpotLamp>DATAH5 X6 84 ModifiersEditingj>DATAX6 h7 H5 ShapesEditing>H5 DATAh7 x8 X6 MultiresEditing>DATAx8 9 h7 Render LayersRender> DATA9 : x8 BakeRender> DATA: ; 9 StampRender> DATA; < : Links and PipelineMaterial>DATA< = ; SSSMaterial>! DATA= > < PreviewTexture>DATA> ? = TextureTextureF>DATA? @ > Radio RenderRadio>DATA@ B ? Radio ToolRadioF>DATAB C @ Object and LinksObjectF>DATAC (D B Curve and SurfaceEditingF>DATA(D C FontEditingDATA8E @F 333? DhCr DhCC(BDC?z?A mDATA@F I 8E 333? ??? ???? A??@PA Aj?c3>}GCHB? A  B? #<C DATAI J @F 333? HE}CHE}C HE}C??DATAJ I 333? /9DATAL M 0   p @Le@Lf@eeA  DATAM \ L 0 >DATAO N View PropertiesView3dT>"DATAP S 333?M HCHCCHEVD??R XR  Q DATA,R XR BOp=A DATA,XR R CS@ff DATA R DATAR      ؇ ଀       8 `Ň H ه  ۇ DATAS W P 333?M ???????? >DATA^ x] View PropertiesView3dT>"DATAX_  a 333?\ zC̽̌??zC@ss #< #<`jFzD ଀ OBzC̽̌?DATA a hd _ 333?\ ????????DATAk j View PropertiesView3dT>"DATAl o 333?i ?%%%i!3?i!3&éJ5 ??%%i!3?%i!3 ?5?%M}%4A??M}?ti!P'5A AM?-,$A,ĤR$-3T ?GBت֟%3D3!(@5??AHM?%%%i!3?i!3&éJ5 ?5?5XޤE? A  B??V/;=CJ7u AB7?X<,,?,,?,,?p@?p@? DATAXo xq l 333?i zC̽̌?zC@22 #< #<`jFzD OBzC̽̌?DATAxq r o 333?i HEVDHEVD2 XHEVD??2DATAr s xq 333?i ?zDzB@22FzD #<HB DATAs t r 333?i DdC8CnD fCC(BDC?z?DATAt s 333?i LSave FileNT PICTURES/Users/ton/Desktop/umpbug Folder/ender.app/Contents/Resources/untitled.blend DATAv  i 0 ?g? JL+,y 0Q 0Q w x DATAw x Transform PropertiesView3d,>"DATAx w View PropertiesView3dT>"DATAy } 333?v ?>FwFw?>oKg??탄>Fw?Fw>i_/to@??/Q>>`w?Fw?-?/dAoKgAj?y*S>qE?d3B䠕(A!@?g? JL?>FwFw?>oKg?5K?oKgAoKgA  B??;=C7?X<???? DATAX} ~ y 333?v zC̽̌?zC@22 #< #<`jFzD OBzC̽̌?DATA~  } 333?v HEVDHEVD2 XHEVD??2DATA  ~ 333?v ?zDzB@22FzD #<HB DATA   333?v DdC8CnD fCC(BDC?z?DATA  333?v LSave FileNT PICTURES/Users/ton/Desktop/umpbug Folder/ender.app/Contents/Resources/untitled.blend DATA  v p 0 #><>o?oo+o,Ȇ Ȏ   DATA  Transform PropertiesView3d,>DATA  View PropertiesView3dT>"DATAȆ  333? ?3?3??3?3?#>1n;<>?{@*H4H@zC?#><>o??3?3?5?5{@?  B??,<=C7?X<???? DATAX  Ȇ 333? zC̽̌?zC@22 #< #<`jFzD OBzC̽̌?DATA Ќ  333? HEVDHEVD2 XHEVD??2DATAЌ  333? ?zDzB@22FzD #<HB DATA Ȏ Ќ 333? DdC8CnD fCC(BDC?z?DATAȎ  333? LSave FileNT PICTURES/Users/ton/Desktop/umpbug Folder/ender.app/Contents/Resources/untitled.blend DATA  0  p DATAȒ x0R View PropertiesView3dT>"DATAx0R Ȓ Find & ReplaceTextxDATAؓ  333?  ]ҿ?13WkDATA З ؓ 333? ??????????_?D pH े DATA zX ଀ DATAX z  DATA( y,d'=A@DATA L?B ?o: ??22 2d 22 22 22 22 22 > #<=2 #< #`fff?Ou<?DATAH 1 RenderLayerSC`  SC2 ROLL TITLE TITLE CAH େ =( dd??< d@d! ??  BB?????//backbuf/tmp/L?L?L??>??_?D h DATA zେ 98 DATAେ z H DATA(( y,d'=A@DATA L?B ?o: ??22 2d 22 22 22 22 22 > #<=2 #< #`fff?Ou<?DATAH 1 RenderLayerCU8 3`Ň CUTextd  0 ~+ G] p1 0+ <Կ-@@ #<d ? #< --????L= Pڇ Pڇ Pڇ Pڇ 0 X DATAG]  DATA0 Preset 1 example Title Card press TAB to editDATAhX 1-DATA0 2CU8`Ň 3 CUText.0010] <:ZԿ-@u @ #<d ? #< --????L=Ƈ Pڇ Pڇ Pڇ Pڇ ȇ (LJ DATA0]  DATA0Ƈ Preset 2 example Roll Title press TAB to editDATAh(LJ 1-DATAȇ 2CA؇ ه CACameraamera.001 ?DB=B B@?CAه ؇ CACamera.001 ?DB=B B@?VFDPڇ +VF IPTۇ IPObIpo@܇ 333sCR&AOBDATA\@܇ ܇  ?zC=OB3DATA\܇ P݇ @܇ ?zC=OBDATA\P݇ ݇ ܇ H ?zC@OBDATA\݇ `އ P݇ ?zCAAOBADATA\`އ އ ݇ ?zCa&=OBa&DATA\އ p߇ `އ ( ?zCa&=OB a&DATA\p߇ ߇ އ ?zC?̌?OB ?DATA\߇  p߇ h ?zC?̌?OB?DATA\ ߇  ?zC?̌?OB?DATAp .l?lBCzC2CDATAp .l?lBCzC2CDATApH .3?3BuC@zC@ŌC@DATAp .lA?AlBACAzCA2CADATAp .la&?a&lBa&Ca&zCa&2Ca&DATAp( .la&?a&lBa&Ca&zCa&2Ca&DATAp .l???lB?C?zC?2C?DATAph .l???lB?C?zC?2C?DATAp .l???lB?C?zC?2C?TXx TX2D Title Presets P hz 8 8  McFADATAP  z DATA  P { DATA ( P{ DATA( p @U DATAp  ( { DATA  p  DATA H { 3DATAH  `EDATA  H  ImagDATA  P| ner DATA h  DATAh  | DATA  h | DATA @ } DATA@  8} BDATA  @ x} DATA  } DATA ` } DATA`   (~ DATA  ` X~ DATA 8 ~ DATA8  ~ 4DATA  8 0 4DATA   DATA X  DATAX   4?DATA  X h 4DATA 0 Ѐ $DATA0 x ( DATAx  0 X -DATA  x DATA P 聈 /DATAP   H .DATA  P .DATA (  +,Q DATA( p ` DATAp  ( *DATA  p 胈 DATA H  ,CDATAH  x DATA  H DATA  1DATA h @ 1DATAh  ,DATA  h 1DATA @ ` +DATA@  DATA  @ .DATA  ` 1DATA ` .DATA`   DATA  ` ` DATA 8 .,Q DATA8  .DATA  8 P ,DATA  ,DATA X  DATAX   X 4DATA  X 4DATA 0 ( DATA0 x X 4?DATAx  0 ,DATA  x 1DATA P DATAP   3DATA  P  3DATA ( p 2DATA( p Ѝ DATAp  (  4DATA  p 9DATA H )ADATAH   )DATA  H ` )DATA  ^ DATA h 菈 '^ DATAh  0 l^ DATA  h ` ^ DATA @ ^ DATA@  ^ DATA  @ ؿQ 4^ DATA  x 0x^ DATA ` ؑ ^ DATA`    ^ DATA  ` @ -J^ DATA 8 ^ DATA8  В 4N^ DATA  8 8 1^ DATA  /\^ DATA X 2^ DATAX   X '^ DATA  X ^ DATA 0 0/^ DATA0 x @ .^ DATAx  0 +8^ DATA  x ^ DATA P  ( '{^ DATAP   ^ DATA  P N^ DATA (  1^ DATA( p  P ^ DATAp  ( ^ DATA  p З -I^ DATA H  0 1^ DATAH   40^ DATA  H 1^ DATA    X .>^ DATA  h  3^ DATAh    ,^ DATA  h x *^ DATA @  К 1Z^ DATA@   0 1^ DATA  @ 1s^ DATA   3^ DATA `  P "K^ DATA`   0L^ DATA  ` 1^ DATA 8  ` 1J^ DATA8   (^ DATA  8  4_ DATA   -_ DATA X  3"_ DATAX   @ 4\'_ DATA  X 3<4_ DATA 0  4A_ DATA0 x p G_ DATAx  0 M_ DATA  x 蠈 1Q_ DATA P H -fk?DATAP   -(DATA  P  DATA ( 8 DATA( p h DATAp  ( DATA  p ࢈ /DATA H @ DATAH  x DATA  H *DATA   -DATA  h ` DATAh   ,DATA  h DATA @  0 DATA@   ` .DATA  @ DATA   /DATA `  P /DATA`   ?DATA  ` 覈 &BDATA 8   !DATA8   h DATA  8 ViewDATA   ا DATA X   DATAX   H DATA  X x 'r?DATA 0  Ш DATA0 x  -XDATAx  0 ` 3,DATA  x /=DATA P  3ZDATAP   4wDATA  P 誈 +DATA (   DATA( p  H DATAp  ( DATA  p /DATA H  4DATAH   28DATA  H 謈 /UDATA    H 2~DATA  h  DATAh   譈 +DATA  h  CDATA @  h DATA@   0&DATA  @  %DATA   X DATA `  *ODATA`   ை RDATA  `  IDATA 8  @ $ZDATA8   iDATA  8 Ȱ 2DATA   ( 1DATA X  4DATAX   ecDATA  X .DATA 0  'DATA0 x  ز -DATAx  0 8 3DATA  x /+DATA P  /DATAP   X 1DATA  P DATA (  0DATA( p  .DATAp  ( .DATA  p ൈ 3DATA H  @ 4DATAH   2DDATA  H  1fDATA   h 2DATA h  ȷ DATAh  1DATA  h X 4DATA @! 4 DATA@! ! ( 2DATA! ! @! *?DATA! " ! ่ .@DATA" `" ! @ 1 mDATA`" " " /DATA" " `" .+DATA" 8# " ` 1#DATA8# # " #DATA# # 8# DATA# $ # lDATA$ X$ # h DATAX$ $ $ DATA$ $ X$ ༈  DATA$ 0% $  0&DATA0% x% $ p 0@DATAx% % 0% н 3jDATA% & x% 0 4 DATA& P& % !DATAP& & & 辈 DATA& & P&  0DATA& (' & x 0DATA(' p' & ؿ 3DATAp' ' (' 8 1DATA' ( p' 4SDATA( H( ' 1DATAH( ( ( ` %DATA( ( H( +DATA(  ) ( -MDATA ) h) ( 8ˆ 1]DATAh) ) ) ˆ DATA) ) h) ˆ /DATA) @* ) (È 3FDATA@* * ) È 2DATA* * @* È lDATA* + * Ĉ DATA+ `+ * PĈ +DATA`+ + + Ĉ 1 DATA+ + `+ ň DATA+ 8, + 8ň 0#DATA8, , + ň 4 DATA, , 8, ƈ DATA, - , 8ƈ 2 DATA- X- , hƈ ( DATAX- - - ƈ DATA- - X- ƈ /'DATA- 0. - PLj 3<<DATA0. x. - Lj %DATAx. . 0. Lj DATA. / x. Ȉ 1 tDATA/ P/ . Ȉ 0ODATAP/ / / Ȉ DATA/ / P/ Ɉ DATA/ (0 / PɈ -DATA(0 p0 / Ɉ 1DATAp0 0 (0 ʈ 1DATA0 1 p0 pʈ 0DATA1 H1 0 ʈ 0 DATAH1 1 1 ˈ ^DATA1 1 H1 @ˈ al*DATA1  2 1 pˈ pnamDATA 2 h2 1 ˈ [128DATAh2 2 2 ˈ 0ngthDATA2 2 h2 @̈ 0]buDATA2 @3 2 ̈ /bjecDATA@3 3 2 ͈ 1sounDATA3 3 @3 `͈ 3lampDATA3 4 3 ͈ 1ainbDATA4 `4 3 Έ treeDATA`4 4 4 XΈ 1stifDATA4 4 `4 Έ 1thtDATA4 85 4 ψ 2get[DATA85 5 4 xψ 3]maDATA5 5 85 ψ 0actoDATA5 6 5 8Ј 4dexDATA6 X6 5 Ј *ks*DATAX6 6 6 Ј )erceDATA6 6 X6 Pш 1x2DATA6 07 6 ш sholDATA07 x7 6 ш ack[DATAx7 7 07 ш t[4]DATA7 8 x7 (҈ 4ietiDATA8 P8 7 ҈ *pt_pDATAP8 8 8 ҈ simpDATA8 8 P8 ӈ 2ereDATA8 (9 8 xӈ 2ildrDATA(9 p9 8 ӈ 3velDATAp9 9 (9 8Ԉ 2schDATA9 : p9 Ԉ 12]DATA: H: 9 Ԉ sim_DATAH: : : Ո 2tepDATA: : H: xՈ 4g*sDATA:  ; : Ո 3ertyDATA ; h; : @ֈ 0mageDATAh; ; ; ֈ 2MetaDATA; ; h; ׈ 2DefoDATA; @< ; `׈ 2tireDATA@< < ; ׈ 2ifieDATA< < @< ؈ 2ureMDATA< = < ؈ 3rDatDATA= `= < ؈ 'ierDDATA`= = = 8و texDATA= = `= hو 1rLayDATA= 8> = و 4tDatDATA8> > = 0ڈ 2BlenDATA> > 8> ڈ rbTDATA> ? > ڈ StriDATA? X? > ۈ /sEfDATAX? ? ? hۈ ensoDATA? ? X? ۈ ctuaDATA? 0@ ? ۈ bIpoDATA0@ x@ ? (܈ #tuatDATAx@ @ 0@ x܈ 0paceDATA@ A x@ ܈ 0xConDATAA PA @ 8݈ 1onstDATAPA A A ݈ deLiDATAA A PA ݈ 1sNoDATAA (B A @ވ &cleKDATA(B pB A ވ DATApB B (B ވ .LDATAB C pB @߈ HDATAC HC B ߈ 8DATAHC C C ߈ 1,DDATAC C HC  4DATAC  D C x 3 DATA D hD C 0*DATAhD D D 8 1%DATAD D hD 4)DATAD @E D 0wDATA@E E D ` DATAE E @E DATAE F E 2@DATAF `F E 8 3DATA`F F F 3DATAF F `F 3#DATAF 8G F X 3'}DATA8G G F /iDATAG G 8G  4DATAG H G DATAH XH G 0DATAXH H H  4DATAH H XH x $ODATAH 0I H 0DATA0I xI H  1DATAxI I 0I x 1W>DATAI J xI 5DATAJ PJ I &DATAPJ J J P 2eDATAJ J PJ +sDATAJ (K J  2 DATA(K pK J h DATApK K (K xDATAK L pK DATAL HL K +DATAHL L L X %DATAL L HL 4CDATAL  M L %DATA M hM L H 22DATAhM M M 1DATAM M hM  1bDATAM @N M h DATA@N N M DATAN N @N +DATAN O N ( 3RDATAO `O N 0DATA`O O O (#DATAO O `O @ <DATAO 8P O p /SDATA8P P O 1wDATAP P 8P 0 DATAP Q P p DATAQ XQ P .DATAXQ Q Q .JDATAQ Q XQ ` + DATAQ 0R Q KDATA0R xR Q .9DATAxR R 0R H 4[DATAR S xR 3&DATAS PS R  DATAPS S S H %DATAS S PS x DATAS (T S "lDATA(T pT S #DATApT T (T ( 0DATAT U pT -%DATAU HU T 3DATAHU U U H .DATAU U HU (%DATAU  V U /DDATA V hV U ` nDATAhV V V DATAV V hV DATAV @W V DATA@W W V @ DATAW W @W p 08DATAW X W .DATAX `X W 0 1DATA`X X X 3DATAX X `X 0?DATAX 8Y X P 'DATA8Y Y X /DATAY Y 8Y  20DATAY Z Y h 3 DATAZ XZ Y - DATAXZ Z Z ( ,DATAZ Z XZ 4{DATAZ 0[ Z .DATA0[ x[ Z P 3DATAx[ [ 0[ +DATA[ \ x[  DATA\ P\ [ H DATAP\ \ \ x 4$DATA\ \ P\ 4DATA\ (] \ H 3FDATA(] p] \ DATAp] ] (] )DATA] ^ p] 0 )7DATA^ H^ ] )!DATAH^ ^ ^ DATA^ ^ H^  4:HDATA^  _ ^ x -CDATA _ h_ ^ rDATAh_ _ _ 4P DATA_ _ h_ 4ADATA_ @` _ DATA@` ` _  DATA` ` @` P DATA` a `  DATAa `a `  ? DATA`a a a  DATAa a `a  4( DATAa 8b a  4^ DATA8b b a  qDATAb b 8b 0 wDATAb c b ` DATAc Xc b  DATAXc c c  DATAc c Xc  /DATAc 0d c X !DATA0d xd c  DATAxd d 0d  DATAd e xd  DATAe Pe d H DATAPe e e x *DATAe e Pe  -DATAe (f e 0 !DATA(f pf e  *DATApf f (f  DATAf g pf  DATAg Hg f H .DATAHg g g  DATAg g Hg  DATAg  h g  1DATA h hh g  DATAhh h h  #DATAh h hh  -DATAh @i h x DATA@i i h DATAi i @i  DATAi j i 8 1DATAj `j i .DATA`j j j 4DATAj j `j ` 2DATAj 8k j 0DATA8k k j 3DATAk k 8k #DATAk l k DATAl Xl k .DATAXl l l ` DATAl l Xl DATAl 0m l 4DATA0m xm l 0 ,DATAxm m 0m  'DATAm n xm  DATAn Pn m  2DATAPn n n x 3DATAn n Pn  4DATAn (o n @ 3DATA(o po n  -DATApo o (o  3DATAo p po ` 3DATAp Hp o  /DATAHp p p  4DATAp p Hp  .DATAp  q p  DATA q hq p 8 DATAhq q q h 4DATAq q hq  DATAq @r q  DATA@r r q 8 DATAr r @r x DATAr s r  DATAs `s r  DATA`s s s  DATAs s `s H DATAs 8t s  DATA8t t s З )DATAt t 8t ( $DATAt u t DATAu Xu t Ș DATAXu u u DATAu u Xu @ DATAu 0v u %DATA0v xv u DATAxv v 0v  +DATAv w xv h DATAw Pw v (DATAPw w w -DATAw w Pw P DATAw (x w DATA(x px w DATApx x (x DATAx y px DATAy Q x h DATAQ Hy y IR 0DATAHy  Q DATA  z Hy M DATA z hz Q DATAhz  z 4DATA$z ********************************401DATA${ *** 2D Title Presets v0.1.1a *** DATA$P{ ******************************** DATA@U DATA${ Deutsch, Franais, Espagnol...?CDATA etDATA4{ Problems with English...? Copy this text. AutomaticDATA "O.K." translation:DATA DATA P| www.google.com/language_tools|%DATA  DATA|  DATA | *Contents*DATA} DATA8} 2D Title PresetsQDATAx} DATA } About (license tutorial etc.)DATA} DATA(~ DATAX~ *2D Title Presets*EDATA~ DATA8~ This is a simple .blend file to offer and show videoDATA80 editors a way of making "crystal clear" 2D titles inDATA  Blender.DATA DATA8 ----------------------------------------------------DATA8h ----------------------------------------------------DATA(Ѐ *The simplest way to use this file*: DATA( DATA0X  Place the cursor/mouse over a "3D" window...DATA REEDATA0聈  ...press "Tab" to edit Preset 1 (change to "MyDATA0H  movie title" etc. - centre your title by e.g.DATA0  hitting "Return" once or twice - depending on@DATA,  the lengths of your title - experiment...)DATA`  DATA,  ...press "Tab" again to exit "Edit Mode".DATA胈 DATA0  Click RENDER (or F12) to render one *singleDATA x  frame*...DATA DATA4  ...F3 to save the rendered frame to your projectDATA4@  folder. (Navigate the "File Browser" by clickingDATA0  on the white folders, "go up" using the "P"DATA4  (= Parent Directory) button..., enter a name forDATA,`  your titles in the free field, click "SaveDATA  Targa" or "Cancel".) DATA0  E.g. home/User/Desktop or similar (dependingDATA4`  on your platform) for the path to the desktop...DATA0  - note the alphabetical order for the foldersDATA  (=directories)...EDATA`  DATA0  Import the rendered title in your NLE... (TheDATA0  current preset 768x576 is meant for a 720x576DATA0P  PAL project in e.g. Final Cut Pro - reason:DATA0  *pixel* aspect ratio...! Always test before?DATA  using in a production!)@DATA8X ----------------------------------------------------DATA8 ----------------------------------------------------DATA( DATA8X ----------------------------------------------------/hoDATA0 Back-up the original .blend in case you makeDATA4 unwanted changes and don't know how-to undo them.DATA CDATA4 If you ever get lost - clicked the wrong button andDATA4 don't know how-to come back to the tutorial: "File"DATA4p menu (top left) > "Quit Blender" - unsaved changesDATAЍ will of course be lost...DATA8 ----------------------------------------------------DATA DATA, +++++++++++++++++++++++++++++++++++++++++EEDATA, +++ Detailed help for using this file +++c?DATA,` +++++++++++++++++++++++++++++++++++++++++^ DATA ^ DATA菈 There are two "Scenes":DATA0 ^ DATA`  SCE:1 TITLE CARD^ DATA  SCE:2 ROLL TITLE^ DATA ^ DATA8ؿQ Switch between 1 and 2 via the pull-down menu at theADATA4x top, left to the coloured field with the Blender^ DATAؑ icon.^ DATA ^ DATA0@ Enter "Edit Mode" for the presets with "Tab".^ DATA ^ DATA8В Note that the Blender interface is context sensitive^ DATA48 and that you have to place the cursor over a "3D"^ DATA0 window when e.g. pressing "Tab" for editing theDATA4 title presets - "Tab" will not work as expected if DATA(X the cursor is placed over this text...!DATA ^ DATA4  Click RENDER (or F12) to render a single frame.^ DATA0@  Click ANIM to render an animation. (Is set to DATA,  Targa - *single frames* will be rendered!)DATA  ^ DATA((  (Press "Esc" at any time to stop/abortDATA  rendering!)^ DATA ^ DATA4 Start using this file by telling Blender where to^ DATA P save your rendered titles to:^ DATA  ^ DATA0З  "Scene" (F10) > "Output" tab (bottom left in^ DATA40 this file): click the folder icon next to "/tmp/"^ DATA8 and navigate to your title's project folder. Enter a^ DATA4 name for your titles in the free field underneath^ DATA0X the "P" button and hit "Return" twice (!) - to DATA4 confirm the name for your titles and to confirm theDATA0 path for where your titles will be saved to.^ DATA,x  (Or: by using "Ctrl"-"Down Arrow" you can DATA4К "Maximize Window" for the "File Browser" and then^ DATA40 see and click SELECT OUTPUT PICTURES or Cancel on^ DATA4 the right... "Ctrl"-"Down Arrow" once more to get^ DATA4 the window back the way it was... - this by the wayDATA$P works for all windows in Blender.) DATA4  The "P" button lets you go up to the next level^ DATA4 of a directory, press "Esc" to abort and exit the^ DATA4` "File Browser" at any time without making changes^ DATA,  Since TITLE CARD and ROLL TITLE are two_ DATA8 different "Scenes" you have to tell Blender for eachDATA0 of them where the titles should be saved to -_ DATA4 Blender is basically an "image programming machine"DATA8@ and will always attempt to do exactly as told - this/_ DATA4 e.g. allows you to choose different file formats inDATA8 the "Format" tab (bottom right) for the two "Scenes"E_ DATAp should you need it..._ DATA P_ DATA4蠈 See the official Blender Wiki (incl. the "Noob to DATA0H Pro Wikibook") for a detailed introduction toDATA0 Blender: wiki.blender.org/index.php/Main_PageDATA DATA8 DATAh OS X ONE BUTTON MOUSEBDATA DATA0࢈ Working in Blender under OS X with a one buttonDATA@ mouse:DATAx  DATA,  One button Apple mouse-click = Left MouseDATA0  Button-click (LMB) with a three button mouseDATA` DATA0  "Command" ("Apple" key)-click = Right MouseDATA  Button-click (RMB)DATA0 DATA0`  "Alt"-click = Middle Mouse Button-click (MMB)DATA DATA0  E.g. for selecting the camera "Cam Title Card"DATA0P inside the "3D View" window use "Command"-clickDATA (= RMB).DATA覈 DATA$ Also worth noting for OS X users:DATAh REEDATA  "Ctrl"-W = SaveDATAا  "Ctrl"-Q = QuitDATA  DATAH  DATA(x MACBOOKS/LAPTOPS (NUMBER PAD EMULATION)DATAШ ? DATA0 MacBooks, Laptops etc.: there is the "EmulateDATA4` Numpad" button. Place the cursor between the top ofDATA0 this text and the header above until you see anDATA4 arrow or a hand (depending on your platform). ClickDATA8 and pull down: "System & OpenGL" > "Emulate Numpad".DATA誈 DATA DATAH PREVIEWING AN ANIMATIONDATA DATA0 Place the cursor over the camera window (middleDATA8 right in this file) and press "Alt"-"A" for playback'DATA4  - "Space" to stop or "Esc" to stop and to go backDATA0謈 to the first frame of the animation (if nothingDATA4H seems to happen: make sure to switch to SCE:2 ROLLDATA TITLE first...).DATA譈 DATA   Up/Down arrows: +/- 10 framesDATA h  Right/Left arrows: +/- 1 frameDATA4  Shift-Up/Down arrow: jumps to the end/beginningDATA  of an animationDATAX 0DATA, See the Blender Wiki for more shortcuts...DATAை DATA ODATA(@ FURTHER EDITING OF THE TITLE PRESETSbDATA  DATA4Ȱ (Make sure that either Title Card or Roll Title isDATA4( selected - depending on whether your are in SCE:1DATA8 TITLE CARD or SCE:2 ROLL TITLE - before proceeding.)DATA DATA0 "Editing" (F9) > "Font" tab can be seen as theDATA( equivalent to an NLE's title generator.DATA0ز  Should you load another font and get strangeDATA48 effects - like a long line coming out of one end ofDATA0 the font: set "Bevel Depth" from 0.010 to 0.000DATA0 (0.000 for "Bevel Depth" also reduces renderingDATA4X times, but may not look as good as with the 0.010}DATA preset.)QDATA DATA0 "Shading" (F5 - again note that you can hit F5DATA0 multiple times to zap through all available F5DATA4ൈ related tabs) is where you can change the colour ofDATA8@ your titles. You can see that in the "Shaders" tab >DATA4 "Emit" is set to 1.000 - meaning that these titlesDATA4 are "glowing" in the dark - and this is why there~DATA4h are no other light sources in those two 3D scenes.DATAȷ DATA4 Now select the 3D camera and then "Editing" (F9):DATA8X this brings up the "Camera" tab where you can changeDATA8 the camera's lens. The distance of the titles to theDATA4( camera, the camera's lens and of course the (speedDATA, of an) animation are all important factorsDATA0่ contributing to the final outcome. (Should youDATA4@ prefer to render your titles orthogonally: select&DATA0 the "Orthographic" option in the "Camera" tab -DATA0 adjustments to the distance between titles andDATA4` camera may have to be made in that case as well.)DATA DATA DATA NAVIGATING IN 3D SPACEDATAh DATA The most important basics:DATA༈  DATA4  Use the *number pad* keys (on the right side of6DATA4p the keyboard) 1, 3 and 7 to switch between frontYDATA4н (1), side (3) and top (7) view inside any "3D View"DATA80 window - just make sure to place the cursor over theDATA$ window that you want to change...DATA辈 %DATA4  *** Note *** If you press instead e.g. 3 on theDATA4x upper row of your keyboard the content of the 3DDATA4ؿ scene "disappears" - solution: press 1 on the upperDATA48 row of the keyboard! (1-9 on the upper row of theDATA8 keyboard let you select the active layer(s) used forDATA4 rendering - in this file only layer 1 is used andDATA` all others are empty.)DATA IDATA0  Use the *number pad* 5 key to switch betweenVDATA48ˆ orthographic view (default) and perspective view.DATAˆ DATA0ˆ  Example: the "3D View" window right under thisDATA4(È text is set to perspective view, the one next to itDATA4È - that appears to be flat - is set to orthographicDATAÈ view.DATA Ĉ DATA,PĈ  Use the *number pad* 4, 6 and 8, 2 keys toDATA4Ĉ move/rotate the "3D View" left/right and up/down.DATAň DATA48ň  Use the *number pad* +/- keys to zoom in/out ofDATA8ň your 3D scene or most other (!) windows/environmentsqDATA ƈ in Blender.DATA8ƈ  DATA,hƈ More advanced options for 3D navigation:DATAƈ rDATA0ƈ  MMB-click and move (or "Alt"-click and move onDATA4PLj OS X with a one button mouse) for moving/rotating aDATALj 3D scene around.%DATALj DATA4 Ȉ  MMB-"Shift"-click move ("Alt"-"Shift"-click move~DATA4Ȉ on OS X with a one button mouse) for panning theXDATAȈ view of a 3D scene.DATA Ɉ DATA0PɈ  You might also want to explore other relatedDATA4Ɉ options like the ones under "View" > "Align View"DATA4ʈ (e.g. Center View to Cursor = "C") or those under DATA4pʈ "Object" > "Snap" ("Shift"-"S" brings up all the$ DATAʈ Snap options).DATAˈ D DATA@ˈ aluDATApˈ MOVING 3D OBJECTSfrDATAˈ  *DATA4ˈ Select e.g. Title Card and press "G" (= Grab) toeraDATA4@̈ move it around. LMB-click (or just click on OS XionDATA0̈ with a one button mouse) to confirm or "Esc" toDATA4͈ abort. (If you just moved the titles and now wantppDATA4`͈ them back to their original position: "Command"-"Z"DATA4͈ on OS X, "Ctrl"-"Z" on other operating systems tothDATA Έ Undo.)[DATA4XΈ  For more precise control: press "G" and then "Z"roDATA4Έ to move the Title Card up or down right along thearDATA4ψ Z-Axis! Pressing "Ctrl" and/or "Shift" while doinglDATA4xψ so allows you to move objects in e.g. steps of 1000DATA4ψ Blender Units (BU) or less, depending on how youw_sDATA88Ј combine "Ctrl" and "Shift" and also depending on howxecDATA,Ј far away you are from the 3D object in the)DATA,Ј "3D View". Experiment to find out more...siDATAPш no_DATAш extDATAш IPO/ANIMATION, RENDERINGtivDATAш [3]DATA8(҈ (Make sure that you are in SCE:2 ROLL TITLE and thatw_sDATA,҈ Roll Title is selected before proceeding.)bDATA҈ imeDATA4ӈ The IPO curve (graph) for the Roll Title is set toaDATA4xӈ "Linear" instead of the default "Bezier". This canhDATA4ӈ be changed via "Curve" > "Interpolation Mode". ("A"DATA48Ԉ to Select All, "Tab" to enter "Edit Mode" and thenaDATA$Ԉ "Curve" > "Interpolation Mode".)maDATAԈ r_tDATA4Ո You can change the length of what will be renderedoDATA8xՈ via F10 ("Scene") > "Anim" tab. The presets "Sta: 1"veDATA4Ո and "End: 250" indicate that currently an animationDATA4@ֈ will be rendered for a length of 250 frames - nongDATA4ֈ matter how long the actual animation - as shown inVDATA4׈ the IPO curve - might be...! (Start/End can simplyeDATA4`׈ be seen as your In/Out points for rendering...) InaDATA4׈ this case 250 frames is just the right lengths foreDATA4 ؈ the "Roll Title" preset. But before rendering yourlDATA4؈ own roll titles make sure that Start and End pointsDATA(؈ really are set the way you want them...DATA8و viCDATA4hو Basic key frame animation is quite simple, yet iticDATA8و can be tricky to get it right if you are new to thisGPdDATA40ڈ - the *order in which you do things* is where mosteDATAڈ mistakes can be made.ElDATAڈ tinDATA0ۈ  Example - if you wanted to change the startingDATAhۈ point for the Roll Title:bDATAۈ  itDATAۈ  - go to SCE:2 ROLL TITLErDATA$(܈  - make sure Roll Title is selectedDATA4x܈  - make sure the *animation is at frame 1* (!!!)racDATA4܈  (see the counter in the "Buttons Window", rightToCDATA48݈  underneath the "3D View" window under this text)CoDATA݈  - press "G" and then "Z"odDATA4݈  - move the Roll Title 6000 Blender Units upwardsstDATA(@ވ  (press Ctrl to move in 1000 BU steps)GDATAވ  - (LMB-)click to confirmDATA0ވ  - press "I" to set a new key frame and selectDATA@߈  "LocRotScale"DATA߈ PDATA4߈  The Roll Title now starts from the centre of theDATA8 frame, it moves slower than before since it now onlyDATA4x has to move a shorter way up to the end point whileDATA4 the length of the animation is still the same... DATA48 This particular change might not be what you wantQDATA8 for your project, but gives you an idea of how to doDATA4 a simple key frame animation in Blender and whatDATA` concepts are involved.DATA DATA4 Frame size is set to 768x576 with a *pixel* aspectDATA48 ratio of 100:100. A work flow for importing BlenderDATA4 rendered titles into an NLE should be tested beforeDATA4 making use of it in a production - 768x576 might beDATA4X one way of being able to use Blender rendered clipsDATA0 in e.g. a Final Cut Pro 720x576 project withoutDATA8 having problems with square and non-square pixels...DATA DATA4 You also have the option of saving frames/moviesDATA8 with an alpha channel: F10 ("Scene") > Format > RGBADATAx (instead of RGB).DATA4  F10 > "Render" tab: try switching from "Sky" toDATA4 "Premul" (= Multiply alpha in advance) when using7DATA4x RGBA - or any other combination depending on whatDATA you want to achieve...DATA [DATA4P The frame rate is set to 25 frs./sec. - adjust allDATA, settings under F10 ("Scene") > "Format" tabDATA4 accordingly if you need e.g. NTSC video instead ofDATAh PAL.DATA DATA DATA, *** SPECIAL NOTE FOR ROLL TITLE PRESETS ***DATAX DATA8 The SCE:2 ROLL TITLE preset may still need some fineDATA( tuning for production use in terms ofDATA4H speed/smoothness of the Roll Title, also dependingDATA4 on the kind of changes you might have to make forUDATA4 your own titles - always test titles before usingwDATAh them!DATA DATA,  A future version of "2D Title Presets" mayDATA4( include a more advanced Roll Title version, for nowDATA4 some technical details to work with: smooth rollDATA, titles can be achieved by moving text...4DATA@ EDATA0p  "...at a rate in pixels per seconds that is anDATA4 even multiple of the field rate of the interlacedDATA0 video format." DATAp DATA0  "For NTSC, good values include 0, 119.88, andDATA0 239.76 pixels per second; for PAL, good valuesDATA,` include 0, 100, and 200 pixels per second."DATA -DATA0  Source: "Best practices for creating text andDATA8H vector graphics for video", livedocs.adobe.com/... -DATA4 (google parts of the quote above to get to the fullDATA URL.)$DATAH DATAx DATA$ PROBLEMS WITH SAVING/OPENING FILESDATA DATA4( If you experience problems with saving/opening aDATA0 .blend file: try replacing special charactersDATA4 (like Umlaute or cedille) in a file's or a folder'sDATA0H name and/or try saving to/opening from anotherDATA, directory with shorter (folder) names...:DATA0  "File" > "Open Recent" might also be useful inDATA` this context.DATA %DATA DATA YOU MADE IT!DATA@ 9DATA4p If you have read these instructions this far youDATA0 have all the chances of successfully producingDATA40 "crystal clear" titles with Blender for your nextDATA4 editing project. Yet you might still have to investDATA4 some time before Blender will become useful as aEDATA(P production tool on a day to day basis: DATA0  Blender is *extremely* versatile, powerful andDATA4 fully configurable (e.g. minimise this text windowDATA4h by dragging its bottom border upwards - again watchDATA0 out for the hand/arrow), but the multitude of DATA0( possibilities also mean that there is a highvDATA8 learning curve depending on what you want to do withDATA0 it. Having said that: producing simple 768x576DATA4P titles - white letters on black background - shouldDATA, be fairly simple with this 2D Title PresetsDATA .blend/tutorial.DATAH DATA8x ----------------------------------------------------DATA8 ----------------------------------------------------DATA4H See also indiworks.wordpress.com/tutorials/ for theDATA DATA,  **************************************** DATA,0  * Video Editing Preset tutorial/.blend *DATA,  ****************************************.DATA DATA8 The *Quick Start* guide shows the very basics needed%DATA0x to quickly get started with the Blender VideoiDATA Sequence Editor (VSE).DATA8 ---------------------------------------------------- DATA8 ----------------------------------------------------DATA DATA  DATAP *About*DATA DATA  DISCLAIMER DATA  DATA8  This tutorial/.blend file is provided "as is" and noDATA8 guarantee for any usefulness is given. Use it *only*DATA at your own risk!_ DATA0 X_ DATA` X_ DATA CREDITSDATA  _ DATA0 Tutorial by indiworks, indiworks.wordpess.com -DATA$X CC 2008 (v.0.1.1a, November 2008)_ DATA Z_ DATA [_ DATA LICENSE (tutorial)DATAH DATA,x This *tutorial*/.blend is licensed under aDATA0 Creative Commons Attribution-Noncommercial-NoDATA$0 Derivative Works 3.0 license. SeeDATA, creativecommons.org/licenses/by-nc-nd/3.0/DATA for the details.DATA  DATA0H This allows you to make copies/share/host thisDATA tutorial as long as:DATA  DATA4   * it remains in its *original* status - downloadDATA  a *fresh copy* via:DATA$  indiworks.wordpress.com/tutorials/DATA0  * you give the author credit by e.g. linkingDATAx  (link above)DATA  * distribute it free of chargeDATA  DATA48 YOU MAY STILL USE THIS .BLEND AS A STARTING POINTDATA0 FOR YOUR OWN COMMERCIAL BLENDER MADE PROJECTS!DATA8 Simply remove this "2D Title Presets" text file onceDATA4` not needed any more, save the .blend under anotherDATA4 name - at the latest before you share a modifiedDATA4 version of this .blend with others - and change theDATA$ "Title Card" and "Roll Title" text.DATA DATA0 YOUR TITLES/CREDITS ARE YOURS - YOUR .BLEND ISDATA` YOURS!DATA DATA8 One reason for the restrictions: to make it easy forDATA00 the author to update the tutorial - multipleDATA( versions simply can not be supported...DATA DATA4 If you are an educator, teacher or trainer YOU MAYDATA4x USE THIS TUTORIAL AS A TEACHING AID in your classesDATA8 (film school, multimedia training or for instructingDATA4@ employees in your company), you may also distributeDATA0 it to your students (but only free of charge,DATA4 unaltered etc. as stated in the license text). WhatDATA4` you may *not* do is e.g. charge money for a one dayDATA0 training that is only based on this tutorial orDATA8  bundle the tutorial with a commercial product like aDATA0 training manual/book or magazine without priorDATA  getting permission to do so...DATA8 DATA8h ----------------------------------------------------DATA  Change LogDATA DATA8 * v0.1 (July 2007)DATAx DATA Initial release.DATA DATA  DATAH * v0.1.1 (July 2008)DATA DATA,З New: "The simplest way to use this file".DATA(( Some text changes for clarification.DATA Some minor corrections.DATAȘ DATA Minor layout adjustments.DATA@ Minor changes 3D texts.DATA( Minor adjustments positions 3D texts.DATA DATA, Changes in the Render buttons > Format tab:DATAh  DATA,  AspX:100, AspY:100 (was AspX:1, AspY:1)DATA0  SCE:2 ROLL TITLE: Targa (was QuickTime, TGA)DATAP DATA New: CC licenseDATA DATA DATA * v0.1.1a (November 2008)DATAh DATA4IR Minor addition to: "The simplest way to use this3EDATA file".DATAM Minor correction (text). EDATA$Q Minor layout adjustments (text).REEDATA8 ----------------------------------------------------OBHH p OBCam Roll Titletl ه ????%%?%%i!3?%i!3 ??????saanaasaa?naa?MZ(??14t?!E3IC3aj1?@4'5?OBd??)d??>)d?u=?????OBH p8 H OBCam Title Card ؇ ????%%?%%i!3?%i!3 ??????saanaasaa?naa?MZ(??14t?!E3IC3aj1?@4'5?OBd??)d??>)d?u=?????OBH8 p଀ OBRoll Titleitle Card.0ۇ `Ň ????%%?%%.;?%.;??????000?0?H?DOBd?? #=?>=u=???@???DATA OBH଀ p8 OBTitle Cardont X ?????%%?%%i!3?%i!3???????saanaasaa?saa?PΙ`zw'?DOBd8? #=?>=u=???@???DATAX MAl *MAWhite Titles EmitK??????????????L?????2?? ף; ף;AA ????????@?=?==??? ????L?L?L?L==ff????DATA  p DATAp BsAr@q?q?p>p=op?p?q@qArGvFuEuDtCtBsBrAr@q@q?q@q@qArBrBsCtDtEuFuKzJyJxIxHwGwFvFuEuFuFvGwHwIxJxJyP}O}N|N{M{LzKzKyKzLzM{N{N|O}UTSSRQ~RSSTZYYXWXYY__^]]]^_edcccdjjijpooouu{{DNA1̩8R SDNANAMEE *next*prev*data*first*lastxyzwxminxmaxyminymax*pointergroupvalval2name[32]typesubtypeflagsaveddatalentotallen*newid*libname[24]usicon_id*propertiesid*idblock*filedataname[240]filename[240]totpad*parentw[2]h[2]changed[2]pad0pad1*rect[2]*obblocktypeadrcodename[128]*bp*beztmaxrcttotrctvartypetotvertipoextraprtbitmaskslide_minslide_maxcurval*drivercurvecurshowkeymuteipoposrelativetotelempad2*weightsvgroup[32]sliderminslidermax*refkeyelemstr[32]elemsizeblock*ipo*fromtotkeyslurph**scripts*flagactscripttotscript*line*formatblenlinenostartendflagscolor[4]pad[4]*namenlineslines*curl*sellcurcselcmarkers*undo_bufundo_posundo_len*compiledmtimesizeseekpassepartalphaangleclipstaclipendlensortho_scaledrawsizeshiftxshiftyYF_dofdistYF_apertureYF_bkhtypeYF_bkhbiasYF_bkhrotscriptlink*dof_obframenrframesoffsetsfrafie_imacyclokmulti_indexlayerpassmenunribufs*gputexture*anim*rrsourcelastframetpageflagtotbindxrepyreptwstatwendbindcode*repbind*packedfile*previewlastupdatelastusedanimspeedgen_xgen_ygen_typeaspxaspy*vnodetexcomaptomaptonegblendtype*object*texuvname[32]projxprojyprojzmappingofs[3]size[3]texflagcolormodelpmaptopmaptonegnormapspacepad[3]rgbkdef_varcolfacnorfacvarfacdispfacwarpfacname[160]*handle*pname*stnamesstypesvars*varstr*result*cfradata[32](*doit)()(*instance_init)()(*callback)()versionaipotype*ima*cube[6]imat[4][4]obimat[3][3]stypeviewscalenotlaycuberesdepthrecalclastsizenoisesizeturbulbrightcontrastrfacgfacbfacfiltersizemg_Hmg_lacunaritymg_octavesmg_offsetmg_gaindist_amountns_outscalevn_w1vn_w2vn_w3vn_w4vn_mexpvn_distmvn_coltypenoisedepthnoisetypenoisebasisnoisebasis2imaflagcropxmincropymincropxmaxcropymaxxrepeatyrepeatextendcheckerdistnablaiuser*plugin*coba*envloc[3]rot[3]mat[4][4]min[3]max[3]pad3modetotexshdwrshdwgshdwbshdwpadenergydistspotsizespotblendhaintatt1att2*curfallofffalloff_typeshadspotsizebiassoftbufsizesampbuffersfiltertypebufflagbuftyperay_sampray_sampyray_sampzray_samp_typearea_shapearea_sizearea_sizeyarea_sizezadapt_threshray_samp_methodtexactshadhalostepsun_effect_typeskyblendtypehorizon_brightnessspreadsun_brightnesssun_sizebackscattered_lightsun_intensityatm_turbidityatm_inscattering_factoratm_extinction_factoratm_distance_factorskyblendfacsky_exposuresky_colorspacepad4YF_numphotonsYF_numsearchYF_phdepthYF_useqmcYF_bufsizeYF_padYF_causticblurYF_ltradiusYF_glowintYF_glowofsYF_glowtypeYF_pad2*mtex[18]specrspecgspecbmirrmirgmirbambrambbambgambemitangspectraray_mirroralpharefspeczoffsaddtranslucencyfresnel_mirfresnel_mir_ifresnel_trafresnel_tra_ifiltertx_limittx_falloffray_depthray_depth_traharseed1seed2gloss_mirgloss_trasamp_gloss_mirsamp_gloss_traadapt_thresh_miradapt_thresh_traaniso_gloss_mirdist_mirfadeto_mirshade_flagmode_lflarecstarclinecringchasizeflaresizesubsizeflarebooststrand_stastrand_endstrand_easestrand_surfnorstrand_minstrand_widthfadestrand_uvname[32]sbiaslbiasshad_alphaseptexrgbselpr_typeuse_nodespr_backpr_lampml_flagdiff_shaderspec_shaderroughnessrefracparam[4]rmsdarkness*ramp_col*ramp_specrampin_colrampin_specrampblend_colrampblend_specramp_showrampfac_colrampfac_spec*nodetree*groupfrictionfhreflectfhdistxyfrictdynamodesss_radius[3]sss_col[3]sss_errorsss_scalesss_iorsss_colfacsss_texfacsss_frontsss_backsss_flagsss_presetYF_arYF_agYF_abYF_dscaleYF_dpwrYF_dsmpYF_presetYF_djitgpumaterialname[256]scale*bbi1j1k1i2j2k2selcol1selcol2quat[4]expxexpyexpzradrad2s*mat*imatelemsdisp**mattotcolwiresizerendersizethreshvec[3][3]alfaweightradiush1h2f1f2f3hidevec[4]mat_nrpntsupntsvresoluresolvorderuordervflaguflagv*knotsu*knotsvtilt_interpradius_interpcharidxkernhnurb*bevobj*taperobj*textoncurve*path*keybevpathlenbevresolwidthext1ext2resolu_renresolv_renspacemodespacinglinedistshearfsizewordspaceulposulheightxofyoflinewidth*strfamily[24]*vfont*vfontb*vfonti*vfontbisepchartotboxactbox*tbselstartselend*strinfocurinfoeffect*mface*mtface*tface*mvert*medge*dvert*mcol*msticky*texcomesh*mselectvdataedatafdatatotedgetotfacetotselectact_facecubemapsizesmoothreshsubdivsubdivrsubsurftype*mr*pv*tpageuv[4][2]col[4]transptileunwrapv1v2v3v4edcodecreasebweightdef_nr*dwtotweightco[3]no[3]uv[2]co[2]indexfis[256]v[4]midpad[2]v[2]*faces*colfaces*edges*edge_boundary_states*vert_edge_map*vert_face_map*map_mem*vertslevelslevel_countcurrentnewlvledgelvlpinlvlrenderlvluse_col*edge_flags*edge_creases*vert_map*edge_map*old_faces*old_edges*errormodifiersubdivTyperenderLevels*emCache*mCachedefaxispad[6]lengthrandomizeseed*ob_arm*start_cap*end_cap*curve_ob*offset_oboffset[3]scale[3]merge_distfit_typeoffset_typecountaxistolerance*mirror_obsplit_anglevalueresval_flagslim_flagse_flagsbevel_angledefgrp_name[32]*texturestrengthdirectionmidleveltexmapping*map_objectuvlayer_name[32]uvlayer_tmp*projectors[10]*imagenum_projectorsaspectxaspectypercentfaceCountfacrepeat*objectcenterstartxstartyheightnarrowspeeddampfallofftimeoffslifetimedeformflagmulti*prevCosparentinv[4][4]cent[3]*indexartotindexforce*clothObject*sim_parms*coll_parms*point_cache*x*xnew*xold*current_xnew*current_x*current_v*mfacesnumvertsnumfacesabsorptiontime*bvhtreeoperationvertextotinfluencegridsizeneedbind*bindweights*bindcostotcagevert*dyngrid*dyninfluences*dynverts*pad2dyngridsizedyncellmin[3]dyncellwidthbindmat[4][4]*psys*dmtotdmverttotdmedgetotdmfacepsysrt[2]*facepavgroupprotect*fss*target*auxTargetvgroup_name[32]keepDistshrinkTypeshrinkOptsprojAxissubsurfLevels*originfactorlimit[2]originOptspntswopntsuopntsvopntswtypeutypevtypewfufvfwdudvdw*defvec[8][3]partypepar1par2par3parsubstr[32]*track*proxy*proxy_group*proxy_from*action*poselib*poseconstraintChannelsdefbasemodifiersdloc[3]orig[3]dsize[3]drot[3]obmat[4][4]constinv[4][4]laycolbitstransflagipoflagtrackflagupflagnlaflagprotectflagipowinscaflagscavisflagboundtypedupondupoffdupstadupendsfctimemassdampinginertiaformfactorrdampingsizefacmargindtdtxactcolempty_drawtypepad1[3]empty_drawsizedupfacescapropsensorscontrollersactuatorsbbsize[3]actdefgameflaggameflag2*bsoftsoftflaganisotropicFriction[3]constraintsnlastripshooksparticlesystem*pd*soft*dup_groupfluidsimFlagrestrictflagshapenrshapeflagrecalcobody_type*fluidsimSettings*derivedDeform*derivedFinallastDataMaskstateinit_stategpulampcurindexactivedeflectforcefieldpdef_damppdef_rdamppdef_permpdef_frictpdef_rfrictf_strengthf_powerf_distf_dampmaxdistmindistmaxradminradf_power_rpdef_sbdamppdef_sbiftpdef_sboftclump_facclump_powkink_freqkink_shapekink_ampfree_endtex_nablatex_modekinkkink_axisrt2*rngf_noisesimframestartframeendframeeditframelinStiffangStiffvolumeviterationspiterationsditerationsciterationskSRHR_CLkSKHR_CLkSSHR_CLkSR_SPLT_CLkSK_SPLT_CLkSS_SPLT_CLkVCFkDPkDGkLFkPRkVCkDFkMTkCHRkKHRkSHRkAHRcollisionflagsnumclusteriterations*particlestotpointtotspring*bpoint*bspringnodemassgravmediafrictrklimitphysics_speedgoalspringgoalfrictmingoalmaxgoaldefgoalvertgroupfuzzynessinspringinfrictefraintervallocalsolverflags**keystotpointkeysecondspringcolballballdampballstiffsbc_modeaeroedgeminloopsmaxloopschokesolver_IDplasticspringpreload*scratchshearstiffinpush*pointcacheshow_advancedoptionsresolutionxyzpreviewresxyzrealsizeguiDisplayModerenderDisplayModeviscosityValueviscosityModeviscosityExponentgravxgravygravzanimStartanimEndgstarmaxRefineiniVelxiniVelyiniVelz*orgMesh*meshSurface*meshBBsurfdataPath[240]bbStart[3]bbSize[3]typeFlagsdomainNovecgenvolumeInitTypepartSlipValuegenerateTracersgenerateParticlessurfaceSmoothingsurfaceSubdivsparticleInfSizeparticleInfAlphafarFieldSize*meshSurfNormalscpsTimeStartcpsTimeEndcpsQualityattractforceStrengthattractforceRadiusvelocityforceStrengthvelocityforceRadiuslastgoodframemistypehorrhorghorbhorkzenrzengzenbzenkambkfastcolexposureexprangelinfaclogfacgravityactivityBoxRadiusskytypephysicsEnginemisimiststamistdistmisthistarrstargstarbstarkstarsizestarmindiststardiststarcolnoisedofstadofenddofmindofmaxaodistaodistfacaoenergyaobiasaomodeaosampaomixaocolorao_adapt_threshao_adapt_speed_facao_approx_errorao_approx_correctionao_samp_methodao_gather_methodao_approx_passes*aosphere*aotableshemiresmaxiterdrawtypesubshootpsubshootenodelimmaxsublamppamapamielmaelmimaxnodeconvergenceradfacgammaselcolsxsy*lpFormat*lpParmscbFormatcbParmsfccTypefccHandlerdwKeyFrameEverydwQualitydwBytesPerSeconddwFlagsdwInterleaveEveryavicodecname[128]*cdParms*padcdSizeqtcodecname[128]codecaudio_codecvideo_bitrateaudio_bitrategop_sizerc_min_raterc_max_raterc_buffer_sizemux_packet_sizemux_ratemixratemain*mat_override*light_overridelay_zmasklayflagpassflagpass_xor*avicodecdata*qtcodecdataffcodecdatacfrapsfrapefraimagesframaptothreadsframelenblurfacedgeRedgeGedgeBfullscreenxplayyplayfreqplayattribrt1stereomodedimensionspresetmaximsizexschyschxpartsypartswinposplanesimtypesubimtypequalityrpadrpad1rpad2scemoderendererocresalphamodeosafrs_secedgeintsafetyborderdisprectlayersactlayxaspyaspfrs_sec_basegausspostmulpostgammaposthuepostsatdither_intensitybake_osabake_filterbake_modebake_flagbake_normal_spacebake_quad_splitbake_maxdistbake_biasdistbake_padGIqualityGIcacheGImethodGIphotonsGIdirectYF_AAYFexportxmlYF_nobumpYF_clamprgbyfpad1GIdepthGIcausdepthGIpixelspersampleGIphotoncountGImixphotonsGIphotonradiusYF_raydepthYF_AApassesYF_AAsamplesyfpad2GIshadowqualityGIrefinementGIpowerGIindirpowerYF_gammaYF_exposureYF_raybiasYF_AApixelsizeYF_AAthresholdbackbuf[160]pic[160]stampstamp_font_idstamp_udata[160]fg_stamp[4]bg_stamp[4]simplify_subsurfsimplify_shadowsamplessimplify_particlessimplify_aossscineonwhitecineonblackcineongammaparticle_percsubsurf_maxshadbufsample_maxao_errorcol[3]framename[64]*brushtoolstepinverttotrekeytotaddkeybrushtypebrush[7]emitterdistdraw_timedname[36]mat[3][3]cornertypeeditbutflagjointrilimitdegrturnextr_offsdoublimitsegmentsringsverticesunwrapperuvcalc_radiusuvcalc_cubesizeuvcalc_mapdiruvcalc_mapalignuvcalc_flagautoik_chainlenimapaintparticleselect_threshclean_threshretopo_moderetopo_paint_toolline_divellipse_divretopo_hotspotmultires_subdiv_typeskgen_resolutionskgen_threshold_internalskgen_threshold_externalskgen_length_ratioskgen_length_limitskgen_angle_limitskgen_correlation_limitskgen_symmetry_limitskgen_optionsskgen_postproskgen_postpro_passesskgen_subdivisions[3]edge_modepad3[4]dirview*session*cumapdrawbrushsmoothbrushpinchbrushinflatebrushgrabbrushlayerbrushflattenbrushpivot[3]brush_typetexnrtexrepttexfadetexsepaveragingtablet_sizetablet_strengthsymmrakeaxislock*camera*world*setbase*basactcursor[3]twcent[3]twmin[3]twmax[3]editbutsizeselectmodeproportionalprop_modeautomergepad5pad6autokey_mode*ed*radioframing*toolsettingsaudiotransform_spacesjumpframesnap_modesnap_flagsnap_target*theDagdagisvaliddagflagssculptdataframe_stepzoomblendximyimspacetypeblockscale*areablockhandler[8]viewmat[4][4]viewinv[4][4]persmat[4][4]persinv[4][4]winmat1[4][4]viewmat1[4][4]viewquat[4]zfaclay_usedpersp*ob_centre*bgpic*localvd*ri*retopo_view_data*depthsob_centre_bone[32]localviewlayactscenelockaroundcamzoompivot_lastgridgridviewpixsizenearfarcamdxcamdygridlinesviewbutgridflagmodeselecttwtypetwmodetwflagtwdrawflagtwmat[4][4]clip[4][4]*clipbbafterdrawzbufxrayflag2gridsubdivkeyflagsndofmodendoffilter*properties_storage*gpdlviewquat[4]lpersplviewverthormaskmin[2]max[2]minzoommaxzoomscrollkeeptotkeepaspectkeepzoomoldwinxoldwinycursor[2]rowbutv2d*editipoipokeyactname[32]constname[32]bonename[32]totipopinbutofschannellockmedian[3]cursenscuractaligntabomainbmainbo*lockpointexfromshowgroupmodeltypescriptblockre_alignoldkeypresstab[7]chanshownzebra*filelisttotfiletitle[24]dir[240]file[80]ofssortmaxnamelencollumsf_fpfp_str[8]*libfiledataretvalmenuact(*returnfunc)()(*returnfunc_event)()(*returnfunc_args)()*arg1*arg2*menup*pupmenuoopsvisiflagtree*treestoresearch_string[32]search_tsesearch_flagsdo_outlinevisstoreflagdeps_flagsimanrcurtileimtypenrdt_uvstickydt_uvstretchpad[5]centxcentyautosnap*texttopviewlinesfont_idlheightleftshowlinenrstabnumbercurrtab_setshowsyntaxoverwritepix_per_linetxtscrolltxtbarwordwrapdoplugins*py_draw*py_event*py_button*py_browsercallback*py_globaldictlastspacescriptname[256]scriptarg[256]*script*but_refsredraws*idaspect*curfont*edittreetreetype*filesactive_filenumtilesxnumtilesyselstateviewrectbookmarkrectscrollposscrollheightscrollareaactive_bookmarkprv_wprv_h*imgoutline[4]neutral[4]action[4]setting[4]setting1[4]setting2[4]num[4]textfield[4]textfield_hi[4]popup[4]text[4]text_hi[4]menu_back[4]menu_item[4]menu_hilite[4]menu_text[4]menu_text_hi[4]but_drawtypeiconfile[80]back[4]header[4]panel[4]shade1[4]shade2[4]hilite[4]grid[4]wire[4]select[4]lamp[4]active[4]group[4]group_active[4]transform[4]vertex[4]vertex_select[4]edge[4]edge_select[4]edge_seam[4]edge_sharp[4]edge_facesel[4]face[4]face_select[4]face_dot[4]normal[4]bone_solid[4]bone_pose[4]strip[4]strip_select[4]cframe[4]vertex_sizefacedot_sizebpad[2]syntaxl[4]syntaxn[4]syntaxb[4]syntaxv[4]syntaxc[4]movie[4]image[4]scene[4]audio[4]effect[4]plugin[4]transition[4]meta[4]editmesh_active[4]handle_vertex[4]handle_vertex_select[4]handle_vertex_sizehpad[7]solid[4]tuitbutstv3dtfiletipotinfotsndtacttnlatseqtimatimaseltexttoopsttimetnodetarm[20]bpad[4]bpad1[4]spec[4]dupflagsavetimetempdir[160]fontdir[160]renderdir[160]textudir[160]plugtexdir[160]plugseqdir[160]pythondir[160]sounddir[160]yfexportdir[160]versionsvrmlflaggameflagswheellinescrolluiflaglanguageuserprefviewzoomconsole_bufferconsole_outmixbufsizefontsizeencodingtransoptsmenuthreshold1menuthreshold2fontname[256]themesundostepsundomemorygp_manhattendistgp_euclideandistgp_erasergp_settingstb_leftmousetb_rightmouselight[3]tw_hotspottw_flagtw_handlesizetw_sizetextimeouttexcollectratememcachelimitprefetchframesframeserverportpad_rot_angleobcenter_diarvisizervibrightrecent_filessmooth_viewtxglreslimitndof_panndof_rotatecurssizepad[8]versemaster[160]verseuser[160]glalphaclipautokey_flagcoba_weightvertbaseedgebaseareabase*sceneendxendysizexsizeyscenenrscreennrfullmainwinwinakthandler[8]*newvvec*v1*v2panelname[64]tabname[64]drawname[64]ofsxofsycontrolsnapold_ofsxold_ofsysortcounter*paneltab*v3*v4*fullwinmat[4][4]headrctwinrctheadwinwinheadertypebutspacetypewinxwinyhead_swaphead_equalwin_swapwin_equalheadbutlenheadbutofscursorspacedatauiblockspanelssubvstr[4]subversionpadsminversionminsubversiondisplaymode*curscreen*curscenefileflagsglobalfname[80]*ibuf*ibuf_comp*se1*se2*se3nrbottomrightxofsyofslift[3]gamma[3]gain[3]saturationdir[160]donestartstillendstill*stripdataorxory*crop*transform*color_balance*tstripdata*tstripdata_startstill*tstripdata_endstill*ibuf_startstill*ibuf_endstill*instance_private_data**current_private_data*tmpstartofsendofsmachinestartdispenddispmulhandsizeanim_preseek*stripfacf0facf1*seq1*seq2*seq3seqbase*sound*hdaudiolevelpancurposstrobe*effectdataanim_startofsanim_endofsblend_modeblend_opacity*oldbasep*parseq*seqbasepmetastackedgeWidthforwardwipetypefMinifClampfBoostdDistdQualitybNoCompScalexIniScaleyIniScalexFinScaleyFinxInixFinyIniyFinrotInirotFininterpolation*frameMapglobalSpeedlastValidFramebuttypeuserjitstatotpartnormfacobfacrandfactexfacrandlifeforce[3]vectsizemaxlendefvec[3]mult[4]life[4]child[4]mat[4]texmapcurmultstaticstepomattimetexspeedtexflag2negvertgroup_vvgroupname[32]vgroupname_v[32]*keysminfacusedusedelemdxdylinkotypeold*poin*oldpoinresetdistlastval*makeyqualqual2targetName[32]toggleName[32]value[32]maxvalue[32]delaydurationmaterialName[32]damptimerpropname[32]matname[32]axisflag*fromObjectsubject[32]body[32]pulsefreqtotlinks**linksjoyindexaxisfbuttonhathatfprecisionstr[128]*mynewinputstotslinks**slinksvalostate_mask*actframeProp[32]blendinpriorityend_resetstrideaxisstridelengthsndnrpad1[2]makecopycopymadepad2[1]track*melinVelocity[3]angVelocity[3]localflagdyn_operationforceloc[3]forcerot[3]linearvelocity[3]angularvelocity[3]butstabutendminmaxvisifacrotdampminloc[3]maxloc[3]minrot[3]maxrot[3]matprop[32]distributionint_arg_1int_arg_2float_arg_1float_arg_2toPropName[32]*toObjectbodyTypefilename[64]loadaniname[64]int_argfloat_arggoaccellerationmaxspeedmaxrotspeedmaxtiltspeedtiltdampspeeddamp*sample*stream*newpackedfile*snd_soundpanningattenuationpitchmin_gainmax_gaindistancestreamlenchannelshighpriopad[10]gaindopplerfactordopplervelocitynumsoundsblendernumsoundsgameengine*lamprengobjectdupli_ofs[3]childbaserollhead[3]tail[3]bone_mat[3][3]arm_head[3]arm_tail[3]arm_mat[4][4]xwidthzwidthease1ease2rad_headrad_tailbonebasechainbasepathflaglayer_protectedghostepghostsizeghosttypepathsizeghostsfghostefpathsfpathefpathbcpathacconstflagikflagselectflagagrp_index*bone*childiktree*b_bone_mats*dual_quat*b_bone_dual_quatschan_mat[4][4]pose_mat[4][4]pose_head[3]pose_tail[3]limitmin[3]limitmax[3]stiffness[3]ikstretch*customchanbaseproxy_layerstride_offset[3]cyclic_offset[3]agroupsactive_groupcustomColcs*grpreserved1groupsactive_markeractnractwidthtimeslidename[30]ownspacetarspaceenforceheadtail*tarsubtarget[32]matrix[4][4]space*proptarnumtargetsiterationsrootbonemax_rootbone*poletarpolesubtarget[32]poleangleorientweightgrabtarget[3]reserved2minmaxflagstuckcache[3]lockflagfollowflagvolmodeplaneorglengthbulgepivXpivYpivZaxXaxYaxZminLimit[6]maxLimit[6]extraFzinvmat[4][4]fromtomap[3]expofrom_min[3]from_max[3]to_min[3]to_max[3]zminzmaxchannel[32]no_rot_axisstride_axiscurmodactstartactendactoffsstridelenblendoutstridechannel[32]offs_bone[32]hasinputhasoutputdatatypesockettype*new_socknslimitstack_indexinternstack_index_extlocxlocyown_indexto_index*tosock*link*new_nodeusername[32]lastyoutputs*storageminiwidthcustom1custom2need_execexectotrbutrprvr*typeinfo*fromnode*tonode*fromsocknodeslinks*stack*threadstackinitstacksizecur_indexalltypes*owntype*selin*selout(*timecursor)()(*stats_draw)()(*test_break)()cyclicmoviesamplesminspeedpercentxpercentybokehcurvedimage_in_widthimage_in_heightcenter_xcenter_yspiniterwrapsigma_colorsigma_spacehuesatt1t2t3fstrengthfalphakey[4]x1x2y1y2colname[32]bktyperotationpreviewgamcono_zbuffstopmaxblurbthresh*dict*nodeangle_ofscolmodmixthresholdfademcjitprojfitshortymintablemaxtableext_in[2]ext_out[2]*curve*table*premultablecurrcliprcm[4]black[3]white[3]bwmul[3]sample[3]offset[2]innerradiusratergb[3]cloneactive_rnd*layerstotlayermaxlayertotsize*pooleditflagvel[3]rot[4]ave[3]numparentpa[4]w[4]fuv[4]foffsetrand[3]*stick_obprev_state*hairi_rot[4]r_rot[4]r_ave[3]r_ve[3]dietimebanksizemulnum_dmcachebpialiveloopdistrphystyperotmodeavemodereacteventdrawdraw_asdraw_sizechildtypedraw_stepren_stephair_stepkeys_stepadapt_angleadapt_pixrotfromintegratornbetweenboidneighboursbb_alignbb_uv_splitbb_animbb_split_offsetbb_tiltbb_rand_tiltbb_offset[2]simplify_flagsimplify_refsizesimplify_ratesimplify_transitionsimplify_viewporttimetweakjitfackeyed_timeeff_hairgrid_respartfactanfactanphasereactfacavefacphasefacrandrotfacrandphasefacrandsizereactshapeacc[3]dragfacbrownfacdampfacabslengthrandlengthchild_nbrren_child_nbrparentschildsizechildrandsizechildradchildflatchildspreadclumpfacclumppowrough1rough1_sizerough2rough2_sizerough2_thresrough_endrough_end_shapebranch_thresdraw_line[2]max_velmax_lat_accmax_tan_accaverage_velbankingmax_bankgroundzboidfac[8]boidrule[8]*eff_group*dup_ob*bb_ob*pd2*part*edit**pathcache**childcachepathcachebufschildcachebufs*target_ob*keyed_ob*latticeeffectorsreacteventstotchildtotcachedtotchildcachetarget_psyskeyed_psystotkeyedbakespacebb_uvname[3][32]vgroup[12]vg_negrt3*renderdata*cacheCdisCvi[3]structuralbendingmax_bendmax_structmax_shearavg_spring_lentimescaleeff_force_scaleeff_wind_scalesim_time_oldstepsPerFrameprerollmaxspringlensolver_typevgroup_bendvgroup_massvgroup_structpresets*collision_listepsilonself_frictionselfepsilonself_loop_countloop_countpressure*pointstotpointsthicknessstrokesframenum*actframegstepinfo[128]sbuffer_sizesbuffer_sflag*sbufferTYPE_charucharshortushortintlongulongfloatdoublevoidLinkLinkDataListBasevec2svec2ivec2fvec2dvec3ivec3fvec3dvec4ivec4fvec4drctirctfIDPropertyDataIDPropertyIDLibraryFileDataPreviewImageIpoDriverObjectIpoCurveBPointBezTripleIpoKeyBlockKeyScriptLinkTextLineTextMarkerTextPackedFileCameraImageUserImageGPUTextureanimRenderResultMTexTexPluginTexCBDataColorBandEnvMapImBufTexMappingLampCurveMappingWaveMaterialbNodeTreeGroupVFontVFontDataMetaElemBoundBoxMetaBallNurbCharInfoTextBoxCurvePathMeshMFaceMTFaceTFaceMVertMEdgeMDeformVertMColMStickyMSelectCustomDataMultiresPartialVisibilityMDeformWeightMTexPolyMLoopUVMLoopColMFloatPropertyMIntPropertyMStringPropertyOrigSpaceFaceMultiresColMultiresColFaceMultiresFaceMultiresEdgeMultiresLevelMultiresMapNodeModifierDataSubsurfModifierDataLatticeModifierDataCurveModifierDataBuildModifierDataMaskModifierDataArrayModifierDataMirrorModifierDataEdgeSplitModifierDataBevelModifierDataBMeshModifierDataDisplaceModifierDataUVProjectModifierDataDecimateModifierDataSmoothModifierDataCastModifierDataWaveModifierDataArmatureModifierDataHookModifierDataSoftbodyModifierDataClothModifierDataClothClothSimSettingsClothCollSettingsPointCacheCollisionModifierDataBVHTreeBooleanModifierDataMDefInfluenceMDefCellMeshDeformModifierDataParticleSystemModifierDataParticleSystemDerivedMeshParticleInstanceModifierDataExplodeModifierDataFluidsimModifierDataFluidsimSettingsShrinkwrapModifierDataSimpleDeformModifierDataLatticebDeformGroupbActionbPoseBulletSoftBodyPartDeflectSoftBodyObHookRNGSBVertexBodyPointBodySpringSBScratchWorldRadioBaseAviCodecDataQuicktimeCodecDataFFMpegCodecDataAudioDataSceneRenderLayerRenderDataRenderProfileGameFramingTimeMarkerImagePaintSettingsBrushParticleBrushDataParticleEditSettingsTransformOrientationToolSettingsBrushDataSculptDataSculptSessionSceneDagForestBGpicView3DSpaceLinkScrAreaRenderInfoRetopoViewDataViewDepthsbGPdataView2DSpaceInfoSpaceIpoSpaceButsSpaceSeqSpaceFiledirentryBlendHandleSpaceOopsTreeStoreTreeStoreElemSpaceImageSpaceNlaSpaceTextScriptSpaceScriptSpaceTimeSpaceNodeSpaceImaSelFileListThemeUIThemeSpaceThemeWireColorbThemeSolidLightUserDefbScreenScrVertScrEdgePanelFileGlobalStripElemTStripElemStripCropStripTransformStripColorBalanceStripProxyStripPluginSeqSequencebSoundhdaudioMetaStackEditingWipeVarsGlowVarsTransformVarsSolidColorVarsSpeedControlVarsEffectBuildEffPartEffParticleWaveEffOopsbPropertybNearSensorbMouseSensorbTouchSensorbKeyboardSensorbPropertySensorbActuatorSensorbDelaySensorbCollisionSensorbRadarSensorbRandomSensorbRaySensorbMessageSensorbSensorbControllerbJoystickSensorbExpressionContbPythonContbActuatorbAddObjectActuatorbActionActuatorbSoundActuatorbCDActuatorbEditObjectActuatorbSceneActuatorbPropertyActuatorbObjectActuatorbIpoActuatorbCameraActuatorbConstraintActuatorbGroupActuatorbRandomActuatorbMessageActuatorbGameActuatorbVisibilityActuatorbTwoDFilterActuatorbParentActuatorbStateActuatorFreeCamerabSamplebSoundListenerSpaceSoundGroupObjectBonebArmaturebPoseChannelbActionGroupbActionChannelSpaceActionbConstraintChannelbConstraintbConstraintTargetbPythonConstraintbKinematicConstraintbTrackToConstraintbRotateLikeConstraintbLocateLikeConstraintbMinMaxConstraintbSizeLikeConstraintbActionConstraintbLockTrackConstraintbFollowPathConstraintbStretchToConstraintbRigidBodyJointConstraintbClampToConstraintbChildOfConstraintbTransformConstraintbLocLimitConstraintbRotLimitConstraintbSizeLimitConstraintbDistLimitConstraintbActionModifierbActionStripbNodeStackbNodeSocketbNodeLinkbNodebNodePreviewbNodeTypeNodeImageAnimNodeBlurDataNodeDBlurDataNodeBilateralBlurDataNodeHueSatNodeImageFileNodeChromaNodeTwoXYsNodeTwoFloatsNodeGeometryNodeVertexColNodeDefocusNodeScriptDictNodeGlareNodeTonemapNodeLensDistCurveMapPointCurveMapBrushCloneCustomDataLayerHairKeyParticleKeyChildParticleParticleDataParticleSettingsParticleEditParticleCacheKeyLinkNodebGPDspointbGPDstrokebGPDframebGPDlayerTLEN   L4( H\$8Tpx(x T8l|LDlh88,< L   @ 84DX`D`t@<l<<\hd4Dd@L@@@<lht(T8pd(4H8P HP`<$$X P$88 x P4 088,@0,Hh(H,(lDLP<< \PLhT`<8l (DtH@,@t<h4,,D,@,4` l\4<$x( (@   ,<8HSTRC6                     !"#$%&'()*+, -./0!!!"1#234./56789  :;<=>$ ?@.AB%%%%C=/DEF GHIJ& %KLM= N$OPQR'STUV%(((WXY) ))Z[\+]^_*`]a b(c(def ghij kl+mn]% ,opqrstuvwxyz{|$O'} ~- . " /01%++ 2 394   %5C@6$@57 .8qr35-$O.4679 -:P     ;Fqr !"#$%&'()*++,-./0123456789:;<=>?@ABCDEFGH2I$O'}<$O=JKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrs tuvwxyz{|}~+<662I>$O?F'} @%A+BBBCDC  $O=# "%EEE"1#2F%FGH9C     $OI&= FbC  @ @ @ @%GFFJ'C $O&=KLMNOPQRJ S!T"T#T$6%&'()%*+,-U.V/ M 0123 45K6789%:O67;<W=PW>?N@A<QX.03 45YBZ%RCSDL1.03 45[E\F]G^1_`_2aHIJbKIcccaL`MbNO P QdR6&%%NSU TNSUVWXYZ[T"T$\]V^_K`Oa&%6%eee bfecdTe] f ggec hec hiiec[jkljec mH k ec n o p qrsjtuv]wlecxy zmec{]n ec|}%]~oec%p ec3 %q ec .]%recsectec muec 3 %+vecF w ec xecyecz{|}~ecNNNNNNK%ec %ec %6ec9ec -ecec} ec  i ec  x%F%"$O&PC% m &    $OIC      =      '} ! " # $%D&2'()*+ , - . /01?23456*789:;<=>F ? &@A$BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_3`a%}bcdefghijklmnopqrstuvwxyz{|}~,%Q}0JJJ$ONB +PRQ  +  $O2I'}     !"#$%&'(%) * +,F- ./012]3456789 =:?;<=%>?x@ABCDEFGHIJKLMNOPQRS_TUmVWXYZ[\]^_`abc defghijkl mn%opqrstuvwxyz{|}~ +F+Fm*mJ2I;+]J+ .      > '} g <% .-m !"K#$%&'()*+,-./0  123456789:;<=+s>?@ABCDEFGHIJKLMNCO PQ3RSTUVW XYZ[\ $@]^_`abcdefghij;i#$%&#$%&#$%&kFl m n$OPopqrstuA.vw$#$%4&xyz{l|s} ~ %+#$%&l|%Y!#$%&+F     #$%&l s9 ~ #$%&l.-;  vsY #$%&vl#$%&*]      ] #$%]+ #$%l#$%&lP >>%Y*#$%&l b%+     86     _ !"#$%&'%()*+,-./0123456789:%2;B<=>?@ABCDEFGHIJKLMNOPQRSTUVW XYZ[\]^_`abcdefghijklmnopqrst%uvwxy6z { | }~% k%A4#'}    [  88%988      -  [$O~0  %    %9p   %  ]j 99-\Ql% !"#$S%&'()?*+E, -. / 01% 2 345%+F=6%789:;%<=%>?%@A Fpxl>BC +D EFG0HIJ+F K -% LxMNOPQR*STJ0UF KVWX% - Y\Z[\]^_ `\abcd`\eh  -Jfgh%ij%~  < -  0klmn  \Z+@op  -qrxs   t%uvwxy \@op?lz{|}~B F+FG\_*_ -_ S0  - t% ++ $Oh]#$%l `vF - %? & j  " ,&       % $O    g% #$%&l sv!!!$O" "" %$O# ## %$*  %  & ]%' ( ) +F* + [\qr%Y, - . /  %+F0 S1 %2      3    S4    S5    S6  %7 77 -888 $OY [\[ 9qr  !::::"9#$%&'+()*+:,;-<<<<./0% T 1 2()3456789:=>;;;;<<<=:>:,> ? @9A BCDE F>G:H:I J KL?MN%@OPDQRST%UVA WXpYZ[%B\]Z%C^_D]^_.E`abcdeFfghiGHjIJ klmnOopqrK s tL _ZpumJvwxyM7Ez{N|}~%OP OOO; @PQ.X%  mX+%2IQRA_ TR% S@%T@UV T=TST)m%Q_Wp " ]^\9mjYWX  ?2?   $O0 %W VUX Y Y 1    Cl   9   *      }{"Z    ! " # $ % & ' ( ) * + ], - . / 0 1 2 %F|Z3 4 5 6 ]7 8 [9 \\\[: ; < ]]] = > ^ ^^ ]? < @ ^A  mB C D ENDB