BLENDER_v248REND 8Quick StartGLOB 8 1 F  SRx SRVideo Editing-Sequench= h  V @ a F ?}@eDATAh= x  DATAx  ( h= eDATA( h x  @eDATAh  ( @DATA  h DATA ( @DATA( h DDATAh  ( @DDATA  h DATA ( @DATA( h DATAh ( DDATA xu ( x  DATAxu r  h= h DATAr  xu h= DATA  r h DATA 8 DATA8  ( x  DATA ȗ 8 ( h DATAȗ  ( h DATA X ȗ ( DATAX   h DATA  X DATA 0 ( DATA0  h h DATA   0 ( h DATA  h  DATAh N  DATAN V h ( h DATAV N ( DATA@  . h= h @@@A) (, 8 ( DATA8 H OutputRender> DATAH X 8 RenderRenderF> DATAX h H AnimRender> DATAh x X FormatRender> DATAx  h Render LayersRender> 8 DATA  x BakeRender> X DATA   StampRender> h DATA    VideoRender> h DATA     AudioRender> h DATA     EditSequencer>DATA     EffectSequencerF>DATA     ProxySequencer>DATA    InputSequencerF>DATA   FilterSequencer>DATA (  AnimAnim>DATA( 8  SoundSound>DATA8 H ( ListenerSoundF>DATAH X 8 SequencerSound>DATAX h H Link and MaterialsEditing>DATAh x X MeshEditingF>DATAx  h ModifiersEditing>DATA  x ShapesEditing>x DATA   MultiresEditing>DATA   Object and LinksObject>DATA   Anim settingsObjectF>DATA   DrawObject>DATA   ConstraintsObject>DATA   PreviewMaterial>DATA    Links and PipelineMaterialF>DATA  !  MaterialMaterial>DATA! ("   RampsMaterial>  DATA(" 8# ! ShadersMaterial>DATA8# H$ (" Mirror TranspMaterial>(" DATAH$ X% 8# SSSMaterial>DATAX% h& H$ TextureMaterial^>DATAh& x' X% Map InputMaterial^>X% DATAx' ( h& Map ToMaterial^>X% DATA( x' ScriptlinksScript>DATA) * 333?@ DdhCDhCC(BDC?z?ADATAX* (, ) 333?@ B̽̌?B̽̌? #< #<`jF@F P SQB̽̌?DATA(, * 333?@ /9DATA . / @ ( x  ( h @Ee@E_@`eAL DATA/ H6 . ( h h 8=H>o?@C@@C d 0 P4 > > DATA0 1 333?/ zCAzCA1||1 A@FB= A qfDATA1 P4 0 333?/ ????????8=H>o?fffA*@??fffApX  B? #<C DATAP4 1 333?/ AVE TARGA/t1.blend9DATAH6  a / 8=i>o?@@7@8 A@7 ; DATA@7 88 333?H6 |CA|CAAA A@FB= A ?DATA88 ; @7 333?H6 ????????8=i>o?fffAD&@??fffApX  B? #<C DATA; 88 333?H6 Save AsGA/home/sun/Desktop/Video_Editing_Preset_v011.blendreset_v01.blendreset.blendxDATA a H6 ( h ( 8=>o?CC d*`d k } } m m DATA m Find & ReplaceTextxDATA`d f 333? a g  MY @46H\DATAXf Hh `d 333? a B̽̌?B̽̌?vv #< #<`jFzD P SQB̽̌?DATAHh k f 333? a ????????8=>o?fffA@??fffApX  B? #<C DATAk Hh 333? a Open Text File/home/sun/Desktop/Quick Startg_Preset_v01.blendset v0.1 xSC`F SCQuick StartcenetagpX xe L M L =PP `M M Pp(#ϙdd??< dd! ?? a a BB?????//backbuf/tmp/L?L?L??>??_?D @p N DATAL zL J[ DATAL zM L _ DATAM zL hpX DATA(`M y,d'=A@DATAM L?B ?o: ??22 2d 22 22 22 22 22 > #<=2 #< #`fff?Ou<?DATAPP TP P hV DATAP Q SQBlue1? AW ?`W BDATAQ R P SQRede1e? AY ?X BDATAR hV Q SQGreen1? A`Z ? Z BDATAS xT SQGo back with Tablack13? A[ ?[ BDATAxT pU S Pe SQGo back with Tabhite313e? A ] ?\ BDATApU xT SQun-Mute me 313e? A^ ?@^ BDATAhV R SQOpen me with Tabde? A_ S pU ?BDATA`W ?DATAW  DATAX ?DATAY DATA Z ?DATA`Z DATA[ DATA[ DATA\ ???DATA ] DATA@^ ??DATA^ DATA_ d@` DATA4` ????????DATAH a 1 RenderLayerCAa CACameraamera.001L>DB=B B@?LAb (LASpot ?????AB>??@d .?A4B?@@@ ???o:??????@?????DATA@d $????C?55?55?a ??????DATAa "??WOdxe xWOWorldg=pb>>===??A@pA A?L= ף;>TXxg TXQuick Startg 3   H W:@!hGADATAg g P3 <0000DATAg @h g 3 <0080DATA@h h g 04 <XDATAh h @h x DATAh i h 4 DATAi `i h  DATA`i i i 4 HDATAi i `i `U DATAi 8j i h5 DATA8j j i  DATAj j 8j Й DATAj k j  DATAk Xk j s XDATAXk k k 5 DATAk k Xk DATAk 0l k 5 DATA0l xl k 86  DATAxl l 0l 6 DATAl m xl X headDATAm Pm l 0n DATAPm m m ! r?DATAm m Pm DATAm (n m 6 +`5DATA(n pn m  DATApn n (n / FREEDATAn o pn 7 ew DATAo Ho n ImagDATAHo o o X7 Iner DATAo o Ho 7 QDATAo  p o P DATA p hp o 8 PDATAhp p p 8 M DATAp p hp 9 PDATAp @q p 9 NDATA@q q p : PDATAq q @q `< DATAq r q x DATAr `r q : DATA`r r r : DATAr r `r 0; DATAr 8s r x DATA8s s r x; DATAs s 8s ; DATAs t s ; MADATAt Xt s h<  LDATAu v xu > ADATAv Pv u 0? PDATAPv v v ? DATAv v Pv ? 1DATAv (w v @@ DATA(w pw v p@ FDATApw w (w @ DATAw x pw (A BDATAx Hx w XA DATAHx x x A DATAx x Hx A MDATAx  y x @B EDATA y hy x B DATAhy y y B PDATAy y hy hC IDATAy @z y C PDATA@z z y `D DATAz z @z D JDATAz { z E GDATA{ `{ z E ?DATA`{ { { E DATA{ { `{ F KDATA{ 8| { F GDATA8| | { G :DATA| | 8| xG DATA| } | G EDATA} X} | H DATAX} } } PH PDATA} } X} H .DATA} 0~ } 0I DATA0~ x~ } `I .CDATAx~ ~ 0~ I PDATA~  x~ @J DATA P ~ pJ JDATAP   J LCDATA  P hK FDATA (  K DATA( p  L MDATAp  ( L DATA  p L DATA H  L PDATAH   8M DATA ؁ H hM MDATA؁    M #DATA  h ؁ 8N DATAh   hN 7?DATA  h N {CDATA @  O M{CDATA@   O LICDATA Ѓ @ P DATAЃ   0P PDATA ` Ѓ P GDATA`   (Q DATA  ` XQ IDATA 8  Q PDATA8   PR DATA ȅ 8 R DATAȅ   R DATA X ȅ R 9DATAX   `S DATA  X S FDATA 0  T ?DATA0 x  8T JDATAx  0 T .DATA  x U DATA P  @U PDATAP   U @?DATA  P 0V >DATA (  `V 5>DATA( p  V P?DATAp  ( HW DATA  p xW w DATA H  W DATAH   W L DATA ؊ H pX  DATA؊    X DATA  h ؊ X L DATAh   hY M DATA  h Y 2] DATA @  HZ g DATA@   xZ PD DATA Ќ @ Z 5 DATAЌ   `[ % DATA ` Ќ [ !B DATA`   [ P DATA  ` `\ w DATA 8  \ HS DATA8   ] I DATA Ȏ 8 ] M DATAȎ   ^ DATA X Ȏ 0^ P DATAX   ^ K DATA  X (_ P DATA 0  _  DATA0 x  _ K DATAx  0 P` Mf DATA  x ` M DATA P  Pa $4 DATAP   a  DATA  P a  DATA (  b  DATA( p  Hb E DATAp  ( b GDATA  p ( 15DATA B   I 15DATAB س  @ LDATAس ؓ B DATAؓ   س d & DATA  h ؓ d Gj' DATAh   Pe O( DATA  h e B!DATA @  @f KDATA@   pf M 15DATA Е @ f LDATAЕ   pg / DATA ` Е g P0 DATA`   h H2 DATA  ` h P4 DATA 8  i y6 DATA8   Hi *s7 DATA ȗ 8 i 8 DATAȗ   i M9 DATA X ȗ Pj J; DATAX   j := DATA  X 0k > DATA 0  `k P@ DATA0 x  k 5TA DATAx  0 Hl B DATA  x xl C DATA P  l fF DATAP   l ?G DATA  P hm PI DATA (  m L DATA( p  n M DATAp  ( Xn P DATA  p n ?DATA H  n ?DATAH   E E?DATA ؜ H po eeeDATA؜    0F eeeDATA  h ؜ o eeeDATAh   p PeeeDATA  h p $eeeDATA @  p PeeeDATA@   hq eeeDATA О @ q eeeDATAО   q eeeDATA ` О r EeeeDATA`   r eeeDATA  ` r eeeDATA 8  r JeeeDATA8   `s eeeDATA Ƞ 8 s PeeeDATAȠ   t 'eeeDATA X Ƞ ht PeeeDATAX   t eeeDATA  X u +eeeDATA 0  pu DATA0 x  u Jd DATAx  0 v K+ DATA  x v 4 DATA P  v  DATAP   w Q DATA  P 8w P DATA (  w K8 DATA( p  0x Pڒ DATAp  ( x DATA  p x Pڕ DATA H  `y җ DATAH   y PJ DATA إ H 0z  DATAإ    `z Q DATA  h إ z F DATAh   X{ = DATA  h { P DATA @  H| DATA@   x| Pˣ DATA Ч @ | GromaDATAЧ   p} ideoDATA ` Ч } MsystDATA`   ~ ----DATA  ` `~ P----DATA 8  ~ DATA8    pDATA ȩ 8 P itorDATAȩ    PButtDATA X ȩ  !DATAX   P DATA  X  7DATA 0   PBDATA0 x  h DATAx  0  QDATA  x  +DATA P  p DATAP    5DATA  P  PZ OfDATA (   DATA( p   PDATAp  ( 8 LDATA  p  +DATA H   DATAH   @ GDATA خ H  DATAخ     DATA  h خ  <DATAh    P0 DATA  h  DATA @  @ DATA@   x DATA а @  K*CDATAа    DATA ` а P PDATA`   Ј FDATA  ` H DATA 8   DATA8    JDATA Ȳ 8 ( PDATAȲ    DATA X Ȳ ؊ ,Q DATAX   ( rDATA  X X P4DATA 0  ؋ KYDATA0 x  P CDATAx  0  PDATA  x @ CDATA P  p JDATAP    K DATA  P ` /CDATA (   DATA( p   PDATAp  ( p D`DATA  p  K6DATA H  ` tDATAH    P3DATA ط H  DATAط    H xDATA  h ط  DATAh    K -DATA  h 8 JDATA @   DATA@    KDATA й @ X O>DATAй   ؓ >^DATA ` й H DATA`   x DATA  `  DATA 8   DATA8   H DATA Ȼ 8  DATAȻ   ȕ " DATA X Ȼ  DDATAX   Ȁ $\DATA  X DATA 0  P 6DATA0 x  DATAx  0 HDATA  x ` P+DATA P  NDATAP   ` ;DATA  P SDATA (  ȃ J;DATA( p  @ P$DATAp  ( ODATA  p @ PDATA H  *DATAH   MDATA  H p DATA    KDATA  h   ? DATAh   -DATA  h LDDATA @  8 uDATA@   x DATA  @ PDATA   ( DATA `  x P DATA`   DATA  ` ( MDATA 8  NDATA8   ( K*DATA  8 +DATA   Ћ FDATA X  H ODATAX   Ȍ LDATA  X H LDATA 0  ȍ KlDATA0 x  @  -DATAx  0 DATA  x -DATA P   DATAP   H JDATA  P O$DATA (  @ P% DATA( p  %[DATAp  (  +DATA  p H KDATA H  M DATAH   @ DATA  H p 8>DATA    ؒ DATA  h   KdDATAh   M{DATA  h ?2IDATA @  p DATA@   HDATA  @  $DATA   p DATA `  I  DATA`    2, DATA  ` x < DATA 8  PDATA8   ( MDATA  8 :DATA    PDATA X  DATAX   LDATA  X @ LDATA 0  DATA0 x  DATAx  0 0 PPPPDATA  x MDATA P  0 ?DATAP   PDATA  P DATA (  P LDATA( p  М MDATAp  ( P DATA  p DATA H  ȝ /DATAH   ( DATA  H X DDATA    О PPPDATA  h  CDATAh   p PPPDATA  h DATA @  ;DATA@   X DATA  @ IDATA   $DATA   X DATA   8 IDATA   M 15DATA 8> 8 ODATA8> 8 *DATA8  8> DATA  8 ( PDATA   LDATA X  ( PDATAX   DATA  X PDATA 0  ` DATA0 x  MDATAx  0  DATA  x @ JDATA P  HDATAP   0 DATA  P ` ?DATA (  Ч DATA( p  DATAp  ( @ DATA  p p #DATA H  DATAH   ;DATA  H X DATA    MDATA  h   ODATAh   DATA  h ت DATA @   PDATA@   IDATA  @ "DATA   P QDATA `  Ь DATA`   GDATA  ` x PDATA 8  NDATA8   x PDATA  8 DATA   ( !DATA X  x DATAX   (DATA  X DATA 0  0 LDATA0 x  x NDATAx  0 DATA  x  DATA P  ( KDATAP    NDATA  P  #DATA (  p DATA( p   KDATAp  (  ODATA  p  ODATA H   DATAH   H LDATA  H  ODATA    H BDATA  h   DATAh    DATA  h  @DATA @   DATA@    HDATA  @ 0 DATA   ` DATA `   FDATA`    DATA  ` 8 DATA 8  x DATA8    PDATA  8 ( LDATA    MDATA X  ( DATAX   x PDATA  X  DATA 0  ( KDATA0 x   DATAx  0  DATA  x  PDATA P   ADATAP    :DATA  P p PDATA (   DATA( p   MDATAp  (  ODATA  p  ,Q DATA H  h get:DATAH    DATA  H  DATA     DATA  h  X DATAh    SizeDATA  h  2DATA @  0 DATA@   ` DATA  @  DATA    9DATA `  @ DATA`   p KDATA  `  F`DDATA 8  `  DATA8    ,DATA  8  DATA    DATA X  P  #DATAX    DATA  X  GDATA 0  H  PDATA0 x   !4pX DATAx  0   D DATA  x H  6DOFDATA P   DATAP    +DATA  P   DDATA (  P  IDATA( p   DATAp  (  DATA  p 0 DATA H  ` -HCDATAH    DATA  H  DATA    0 DATA  h  ` DATAh    HCDATA  h  yDATA @   DATA@   @ DATA  @  DATA    "DATA `   DATA`   8 0ax*DATA  `  totDATA 8   totvDATA8    $ightDATA  8 P tartDATA    3imeDATA X   menrDATAX    ?flagDATA  X  xuvDATA    J_varDATA x   15DATAx   h emgDATA  x P $ltypDATA P   loc[DATAP    11atDATA  P  rea_DATA (   EreadDATA( p  ( umphDATAp X (  foruDATAX 0 p ` foruDATA0 @  X E 15DATA@  И 0 H I *teDATAИ X! @  s K DATAX! ! И XDATA!  X! ` J! DATA  ! C K!DATA   15DATA  X multDATA  ( DATA  el_mDATA H   mirDATAH    (flagDATA  H X ame[DATA     LrefDATA  h   ss_rDATAh   8 LF_agDATA  h  AendeDATA @  ( rnhDATA@   X spaDATA  @  artDATA    0dataDATA `  8 aseDATA`   h %edgeDATA  `  *verDATA 8   +ranDATA8   H valuDATA  8 x 7bjecDATA    fftDATA X   collDATAX   @ #htreDATA  X  ]dyDATA 0   #TargDATA0 x   ypewDATAx  0 @ Ln*pDATA  x  +isflDATA P   dupDATAP   H K]coDATA  P  einDATA (   f_dDATA( p  ( "ink_DATAp  ( x nspDATA  p  GPRkDATA H   IlmaDATAH    Jer_IDATA  H ! sityDATA    P! bbSDATA  h   ! MothiDATAh     " OslaDATA    h  " PtarbDATA  @   # :rox_DATA@     h# convDATA    @  # KwBytDATA     $ Jet_sDATA    $ edgDATA     8 M 15DATA     8% &ammaDATA  `   % IcacDATA`    P 15DATA 8  `  15DATA8     GIphDATA  X  8  X& ineoDATAX      & shtyDATA    X  & KmitDATA  0  H' int_DATA0 x  ' en_lDATAx  0 ' #stprDATA  x ( rbruDATA P  8( slocDATAP   h( $deaDATA  P ( sscDATA (  ( Kt[4]DATA( p  h) NcamDATAp  ( ) NkeyDATA  p h* PitipDATA H  * sstDATAH   + <iledDATA  H + o_oDATA    + IpviDATA  h  0, KlobaDATAh   , (posDATA  h - [4]DATA @  0- Hile[DATA@   - @t[4]DATA  @ . [2]DATA   H. KitioDATA `  . #metDATA`   / ndirDATA  ` @/ IonsoDATA 8  / Otb_DATA8 0  E L 15DATA0  8 O 15DATA  0 0 zexDATA   0 :ofsyDATA X  @1 win_DATAX   p1 GplayDATA  X 1 ataDATA 0  2 uf_eDATA0 x  H2 Jim_pDATAx  0 2 tackDATA  x 2 LxFinDATA P  p3 Lld[4DATAP   3 eyqDATA  P 04 isflDATA (  `4 ynewDATA( p  4 PnrpDATAp  ( 5 PminlDATA  p 5 EratiDATA H  6 IainDATAH   6 @zwidDATA  H 6 tflaDATA    7 I3]pDATA  h  7 PkerDATAh   8 CeorDATA  h 8 P4]fDATA @  9 QputDATA@   9 m2nDATA  @ 9 r_inDATA   9 erceDATA `  : t2DATA`   P: *noDATA  ` : ableDATA 8  : GtlayDATA8   0; 4dmcaDATA  8 ; rnbDATA   ; implDATA X  ; ctaDATAX   0< ranDATA  X `< Jgh1DATA 0   < *effDATA0  x   = ffecDATAx    0  @= 12]DATA  ! x  p= effDATA! P!  = s*cDATAP! ! ! = <kesDATA! ! P! P> >c2dDATA! (" ! > ;LineDATA(" p" ! (? bNodDATAp" " (" X? DtMEDATA" # p" ? tireDATA# H# " @ EaCuDATAH# # # x@ #DecDATA# # H# @ :ClotDATA#  $ # 0A artiDATA $ h$ # A fierDATAh$ $ $ A JSBSDATA$ $ h$ (B JaPaDATA$ @% $ B MpaceDATA@% % $ C 8ThemDATA% % @% C uginDATA% & % C JBuiDATA& `& % 0D ?bRaDATA`& & & D ScenDATA& & `& D JctuaDATA& 8' & HE EelbDATA8' ' & E JtbMDATA' ' 8' 8F JformDATA' ( ' F PImagDATA( X( ' 0G LLensDATAX( ( ( G NyerDATA( ( X( 0H @DATA( 0) ( hH HDATA0) x) ( H 4DATAx) ) 0) H PDDATA) * x) HI DATA* P* ) I DATAP* * * I DATA* * P* I !DATA* (+ * J %DATA(+ p+ * `J VDATAp+ + (+ J gDATA+ , p+ J $ODATA, H, + K DATAH, , , 8K ,DATA, , H, K 5DATA,  - , K $DATA - h- , L 6DATAh- - - PL 2DATA- - h- L 8DATA- @. - L DATA@. . - M kDATA. . @. PM DATA. / . M DATA/ `/ . M 7+DATA`/ / / 0N P# DATA/ / `/ N DATA/ 80 / N FDATA80 0 / O PJ'DATA0 0 80 O P6DATA0 1 0 P HSDATA1 X1 0 P P%DATAX1 1 1 Q JiDATA1 1 X1 Q NoDATA1 02 1 R M3DATA02 x2 1 R ONDATAx2 2 02 S DATA2 3 x2 @S PxDATA3 2 S PIDATA@P3 ************************************************************DATA@3 * Blender Video Sequence Editor (VSE) Quick Start (v0.1.1) *DATA@04 ************************************************************  DATAx DATA$4 Deutsch, Franais, Espagnol...?DATA etDATAL4  Problems with English...? Copy this text. Automatic "O.K." translation:@ DATA`U REEDATA h5  www.google.com/language_toolsDATA  REEDATAЙ REEDATA  *Contents*DATAs DATA5  Quick Start:EEDATA REEDATA5  Editing/VSE BasicsDATA86  Add Media/Export MediaDATA6  Questions/AnswersDATAX etDATA0n  DATA!  About:DATA  DATA,6  Disclaimer, Credits and License (tutorial)DATA  DATA/  DATA7 *Quick Start*EEDATA x15DATALX7  Quick Start shows the very basics needed to quickly get started with theDATA 7 Blender Video Sequence Editor.DATAP DATAT 8 --------------------------------------------------------------------------------ADATAP8  Note that Blender *2.46 or above* is strongly recommended for video editing,DATAT 9 previous versions lack certain important features. See the coloured field at theDATAP9 top of this file for your Blender version as well as the download information!DATAT : --------------------------------------------------------------------------------DATA`< DATAx DATA: ++++++++++++++++++++++++++DATA: +++ Editing/VSE Basics +++DATA0; ++++++++++++++++++++++++++DATAx DATAx;  This covers: DATA; RDDATAP;  Navigation - Shorten/Extend - Moving A Clip - Snapping - Cut - Delete - MoreADATAh< REEDATAP<  (also includes: selecting, dropping clips; shows: frame counter, "Channels")DATA= DATATH= --------------------------------------------------------------------------------DATAL=  If you ever get lost - clicked the wrong button and don't know how-to comeDATAP@> back to the tutorial: simply Quit Blender (Ctrl Q) and open this file again.DATAD> (Changes will of course be lost, but this is just a tutorial...!)DATAT0? --------------------------------------------------------------------------------DATA? DATA4?  *** Navigation *** (also mentions frame counter)DATA@@ DATAHp@  Place the cursor (mouse) over the timeline (the large window with theDATA@  coloured clips) DATA(A DATAXA  andDATAA DATAPA  LMB-click (LMB = Left Mouse Button; OS X Apple mouse: simple click) and moveDATAH@B your mouse over the timeline to move the playhead (= the green line).DATAB XDATATB --------------------------------------------------------------------------------DATALhC  LMB-click the timeline/playhead and move the mouse to move the playhead.DATATC --------------------------------------------------------------------------------DATA`D  DATALD  (In case you made a mistake, moved the whole timeline etc. and don't knowDATAHE how-to get it back the way it was: on the keyboard press Home or in theDATA@E *timeline's* View menu (bottom left timeline) select View All.)DATAE REEDATAL F  For a precise playhead navigation use the Right/Left and Up/Down Arrows onDATAHF your keyboard (make sure to place the cursor over the timeline first!):DATA<G Right/Left Arrow +/- 1 and Up/Down Arrow +/- 10 frames... ADATAxG DATAHG  See also the frame counter under the timeline (about middle left)...DATA H ? DATATPH --------------------------------------------------------------------------------DATA0H  Right/Left Arrow = moves playhead +/- 1 frameDATA0I DATA0`I  Up/Down Arrow = moves playhead +/- 10 framesDATATI --------------------------------------------------------------------------------DATA@J DATALpJ  Note that Blender windows are "context sensitive": if the mouse is placedDATAPJ over this text (even without clicking first!) e.g. Up Arrow will simply workDATAHhK like in any standard text editor. Try it out to see the difference...!DATAK DATAPL  Explore later: View menu (bottom left timeline) for more like Alt-A for PlayDATAL Back...DATAL REEDATAL  * selecting DATA8M DATAPhM  RMB-click (RMB = Right Mouse Button; OS X Apple Mouse: press "Apple key" andDATA$M click) the green clip to select it.DATA8N DATA8hN  The clip's name and border turn white when selected...DATAN ?DATAPO  Now RMB-click the blue clip, but this time only click at the very end of the?DATAPO clip where you can see a small triangle ("<")... The triangle turns white...>DATAP DATAT0P --------------------------------------------------------------------------------DATAHP  RMB-click a clip (somewhere in the middle) to select the whole clip orDATA(Q DATALXQ  RMB-click start/end of a clip to just select start/end (white triangle).DATATQ --------------------------------------------------------------------------------DATAPR REEDATAR  *** Shorten/Extend ***DATAR REEDATA<R  Once the blue clip's end is selected (triangle is white)DATA`S DATAHS  press "G" (= Grab) on your keyboard and move the mouse to the left...DATAT DATAL8T  When the white number on top of the clip says "225" confirm the change byDATA0T LMB-clicking (OS X Apple Mouse: simple click).DATAU DATAT@U --------------------------------------------------------------------------------DATADU  When *start* or *end* of a clip is *selected* (white triangle):>DATA0V REEDATA8`V  G = Grab to shorten/extend start or end of the clip.?DATATV -------------------------------------------------------------------------------->DATAHW  DATAxW  *** Moving A Clip *** DATAW  DATAPW  Now once more RMB-click (OS X: "Apple"-click) the whole blue clip (no white DATApX triangle...!) and once moreDATAX  DATAPX  press "G" on your keyboard and move the mouse... - this time the whole clip DATAPhY moves... press "Esc" (top left on keyboard) to abort (no change is made). (If DATA4Y you already made a change Ctrl Z/Apple Z to Undo.) DATAHZ  DATATxZ -------------------------------------------------------------------------------- DATA8Z  When *a whole clip is selected* (no white triangle): DATA`[  DATA$[  G = Grab to move the whole clip. DATAT[ -------------------------------------------------------------------------------- DATA`\  DATAL\  Also note that when you move the blue clip over the green clip the blue DATAL] clip's border turns red: Blender warns you that the clips overlap... Have DATAP] another look...! (Use Esc to abort/no change made or Ctrl Z/Apple Z to Undo.) DATA^  DATAT0^ -------------------------------------------------------------------------------- DATAL^  A clip's border turns red when it is moved and overlaps with another clip.DATAT(_ -------------------------------------------------------------------------------- DATA_  DATAL_  Now move the playhead (the green line) to the first frame of the blue clipDATAPP` (this is frame 201 - assuming the blue clip was not moved). You could use the DATAP` Right/Left and Up/Down Arrows for doing this - or click directly in the frame DATA(Pa counter, type 201 and hit Return...! DATAa  DATAa  *** Snapping *** DATAb  DATAHHb  G-grab the blue clip once more, move it upwards and hold down "Ctrl" DATAHb (bottom left on the keyboard)... ...clip and playhead are "magnetic"...DATA( 2DATAL   ...now move the blue clip to the left and place it above the green clip: DATAP@ this time snap the blue clip's end to the playhead... (Press Esc to abort orDATA Ctrl Z/Apple Z to Undo.)1EDATAd & DATAHd  Ctrl-snapping also works for clip/clip: move the playhead away to e.g.DATAPPe somewhere in the middle of the blue clip, G-grab the green clip, move it out ofDATADe its place and then fit it back into place while holding down Ctrl.EDATA@f DATAPpf  (You can do this without snapping of course, but Ctrl-snapping allows you toDATAPf work much faster e.g. when adjusting very short clips in a large project...)1TDATApg 0 DATATg --------------------------------------------------------------------------------2 DATAL h  Ctrl (when moving a clip) = snapping (for clip/clip and clip/playhead!)4 DATATh --------------------------------------------------------------------------------5 DATAi 6 DATA,Hi  * dropping clips (also mentions Channels) DATAi 9 DATAPi  Move the blue clip up again one "row" (= Channel) and on Channel 2 (note the DATALPj "2" at the left side end of the timeline...) drop the clip by LMB-clicking DATA<j (LMB = Left Mouse Button; OS X Apple mouse: simple click). DATA0k ? DATAT`k --------------------------------------------------------------------------------@ DATA8k  When *moving* or when *shortening/extending* a clip: DATAHl C DATA xl  LMB-click = confirms a change.DATAl G DATA@l  Or: press Space to confirm a change (can be better/faster...!)DATAThm --------------------------------------------------------------------------------K DATAm L DATAn  *** Cut ***O DATAXn P DATAn  Select the green clip...R?DATAn Q DATAHE  ...move the playhead to somewhere in the middle of the green clip...DATApo eeDATA0F  and press "K".DATAo eeDATATp --------------------------------------------------------------------------------eeDATA(p  K = Cut (clip needs to be selected)eeDATATp --------------------------------------------------------------------------------eeDATAhq eeDATAq  *** Delete ***DATAq eeDATAHr  Make sure that one of the two green clips (from the previous cut) iseDATA r selected.EEDATAr eeDATALr  Press "X"... and... LMB-click (OS X: simple click) to confirm "Erase...".DATA`s eeDATATs --------------------------------------------------------------------------------eeDATA(t  X = Delete (clip needs to be selected)DATATht --------------------------------------------------------------------------------eeDATAt eeDATA,u  *** More *** (*New* in Quick Start v0.1.1)DATApu  DATALu  Selected shortcuts and tips for *moving beyond the basics* - skip to "Add DATALv Media/Export Media" below if you just need the absolute essentials for now!DATAv  DATAv  * working in the timeline DATAw  DATAT8w -------------------------------------------------------------------------------- DATALw  Number Pad . (Dot/Del key) = View Selected (clip) ("zoom in" on selection)DATAT0x -------------------------------------------------------------------------------- DATAx  DATATx -------------------------------------------------------------------------------- DATA `y  Shift D = Duplicate (a clip) DATATy -------------------------------------------------------------------------------- DATA0z  DATAT`z -------------------------------------------------------------------------------- DATAHz  Press G and then Y = to move a clip vertically (up or down a Channel) DATA@X{ without changing its position in time (G = Grab, Y = Y-axis). DATAT{ -------------------------------------------------------------------------------- DATAH|  DATATx| -------------------------------------------------------------------------------- DATAH|  G-move a clip across the timeline and press Shift = to move it slower.DATAp} REEDATAP}  (If nothing seems to happen: zoom out (number pad +/- or mouse wheel) of theonDATA ~ timeline first.)DATAT`~ -------------------------------------------------------------------------------- DATA~ DATA  * snap editingDATAP o WDATAT --------------------------------------------------------------------------------ADATA$  When *a whole clip* is selected:DATAP DATA8  Shift S = snaps the clip (with start) to the playhead.DATAT --------------------------------------------------------------------------------DATAh DATAT -------------------------------------------------------------------------------- DATA,  When *start or end* of a clip is selected:DATAp DATA8  Shift S = shortens/extends the clip to the playhead.DATAT --------------------------------------------------------------------------------DATA DATAT --------------------------------------------------------------------------------DATAP8  Be creative with shortcuts: e.g. snap editing also works for multiple clipsDATA, (in different Channels) at the same time...DATA DATAH@  The same is the case for G (= Grab) (for both whole clip and start/endDATA  selected).EDATA / DATA@   (Press Shift and RMB-click to add a clip to a selection...))DATAT --------------------------------------------------------------------------------DATA DATA @  * playbackDATAx DATAL  Place the cursor over the "Image Preview" window (top right in this file):DATA  DATATP --------------------------------------------------------------------------------DATAHЈ  Space = start/stop playback (this *only* works in the "Image Preview"DATA H window!)DATA DATAL  Esc = abort/stop playback and move the playhead back to where it started.DATAT( --------------------------------------------------------------------------------DATA DATA$؊  For (almost) full screen video:DATA( $DATATX --------------------------------------------------------------------------------DATAL؋  "Image Preview" > View menu > Maximize Window (zoom in/out with number padDATADP +/- or the mouse wheel and press Shift to zoom in smaller steps...)DATAT --------------------------------------------------------------------------------DATA@ DATALp  To view the content of a single clip/strip in a multi Channel compositingDATAL situation - without having to Mute all other clips - e.g. the green clip onDATA0` Channel 1 and the blue clip above on Channel 2:DATA DATAT --------------------------------------------------------------------------------3DATAHp  LMB-click the strip that you want to solo view and move the cursorVDATAL (playhead) = "Image Preview" then only shows the content of that particularDATA` strip.DATAT --------------------------------------------------------------------------------DATA cDATAH  * tool tips and shortcutsDATA DATAL  Move the cursor over virtually any button in Blender and wait a moment forDATAL8 the "Tool Tips" to show up: a short description/help text for each button!DATA DATAL  Combine this with exploring the menus under a window (e.g. timeline: View,DATAPX Select or Strip) when looking for a particular feature and find/learn shortcutsDATA@ؓ fast: they are conveniently mentioned inside all the menus...!DATAH DATAx DATA  ++++++++++++++++++++++++++++++DATA  +++ Add Media/Export Media +++DATA H ++++++++++++++++++++++++++++++DATA  DATA$ȕ  *** Add Media (Space > Movie) ***DATA ODATA(Ȁ  Place the cursor over the timeline,oDATA DATA8P  hit Space... Choose e.g. the second option "Movie"...DATA DATAL  (if your video has *sound* then choose *Movie + Audio (HD)* - note thatDATAT` *sound support* for the *Blender VSE (v2.48a)* is *limited* to what *FFMpeg* canDATAP handle - see Questions/Answers (the last part of this text) for links to learnDATA` more)EDATA $DATALȃ  ...then navigate the "File Browser" to your video footage by clicking theDATAT@ white folders (= directories) and by using the P (Parent Directory) button (notelDATAP that you can always exit - no changes made - the "File Browser" with Esc). E.g.DATAT@ for the desktop the path might be - depending on your platform - something like:DATA DATAP  home/User/Name/Desktop - note the alphabetical order for your directories...DATAp DATAL  LMB-click (OS X simple click) to select your video file and then LMB-clickDATA@ Select Movie (on the right) to confirm or hit Return (twice)...DATA :DATAP  ...move the clip to where you want it in the timeline and hit e.g. Space todDATA8 drop the clip.DATAx DATAT --------------------------------------------------------------------------------DATA (  Space > Movie = to add videoDATATx --------------------------------------------------------------------------------DATA DATAP(  Tip 1: towards the bottom left of the "File Browser" there is a little ghostDATAP symbol - click it to hide all dot files (those files usually are invisible andDATAL( navigating the "File Browser" with the dot files hidden is much easier...).DATA ;DATAHЋ  Tip 2: once you have set the path to your project folder in the "FileDATAPH Browser" you can save this .blend file (F2 to Save As... or Ctrl W to Save) andDATAPȌ Blender will remember the path even when you closed/opened the file: use theDATAPH small pull-down menu under the P button (have a look...): the *path* will be%DATALȍ *there to select* - no need to do the above again - this allows you add newDATA@ media very quickly...!DATA `DATA0  *** Export Media (Render buttons > ANIM) ***DATA DATALH  When you select e.g. the blue clip you can get some information about theDATAP clip in the Sequencer buttons window (under the timeline, bottom of this file).DATAT@ There is not so much to see in this case, but when you select e.g. video footageDATA( then there is more - explore later...DATA DATALH  For now just note the small film strip icon over the the Sequencer buttonsDATAP window - left of the frame counter - together with a couple of other icons...%DATA@ 3DATA<p  Now hit F10 (a couple of times) and see what happens...ODATAؒ ^DATAL  Each time you hit F10 the content of the "Buttons Window" changes - at theDATAP same time another one of the small icons above comes into focus... All in allDATA@ there are (as of Blender 2.48a) four different options for F10.DATAp QDATAL  When editing video with Blender you most of the time will only need the\DATA( Sequencer buttons (film strip icon).DATAp  DATAL  But when exporting/rendering media you will want to switch to the Render! DATA4 buttons - to the icon left of the film strip icon.DATAx DATAT --------------------------------------------------------------------------------DATAP(  Use F10 to switch between the Sequencer buttons (for editing) and the RenderDATA< buttons (for exporting). Or click their icons to switch...DATAT --------------------------------------------------------------------------------ssDATA DATAP  Should you ever get lost in the "Buttons Window" (clicked on the wrong iconDATAP@ and can't see the film strip icon any more): *hit F10* to get the film stripDATA icon back...!DATA DATAT0 --------------------------------------------------------------------------------DATAP  Simply hit *F10* in case you get lost in the "Buttons Window" and want to goDATA@0 back to either the *Sequencer buttons* or the *Render buttons*!DATAT --------------------------------------------------------------------------------DATA DATAPP  Make sure that you switched to the Render buttons window (icon next to filmDATAPМ strip icon) - the Render buttons window is the one with the two large buttonsDATAP that say RENDER and ANIM...DATA DATA0ȝ  When exporting media you have to tell Blender:DATA( DATAHX  1) which part of your video sequence (timeline) should be exported.DATAО PPDATAD  In the Anim tab (the tab with the large ANIM button) there are twoDATA p fields at the bottom that say:DATA  DATA<  "Sta: 1" and "End: 250" (= Start/End frame for the export)DATAX DATAL  Click to change... Think of this like setting the In/Out points in otherDATA( NLEs before exporting a selection...DATAX DATAL8  (Note for later: the Start/End frames set here also define the area that DATAP will be played back *in a loop* if you select View > Play Back... (= Alt A) -DATAP8 make sure to *adjust the End* frame for *playback* of the *whole* sequence whenDATA, your project keeps growing in lengths...!) DATA DATAT( --------------------------------------------------------------------------------DATAP  Before exporting media tell Blender which part of the video sequence shouldDATAT( be exported by setting the Start/End frame in the Anim tab in the Render buttonsDATA window.DATAT --------------------------------------------------------------------------------DATA` DATAP  2) Next make sure to tell Blender that you want to export a video sequence -DATA DATAL@  this is necessary since Blender is also a 3D programme and otherwise willDATAL export the default 3D scene (a cube). To let Blender know what you want:DATA0 DATA@`  in the Anim tab, just under the ANIM button, make sure that...DATAЧ DATA  Do SequenceDATA@ DATA$p  ...is selected (button is darker).DATA DATA<  (Do Sequence is selected in *this preset* (as of v0.1.1).)DATAX DATAP  Think of this like changing gears when working with a powerful machine - nowDATAP the machine knows what you want... (You only have to do this once for a projectDATA$ as long as you save the .blend.)DATAت DATAT --------------------------------------------------------------------------------DATAL  Before exporting media make sure that Do Sequence in the Anim tab in theDATA$ Render buttons window is selected.DATATP -------------------------------------------------------------------------------- DATAЬ DATAH  3) Since all other options are already set for this preset (Format tabDATATx 640x480, FFMpeg, 25 FPS *); Video tab MPEG-4 **) - change to Quicktime or AVI ifDATAP needed - and Audio tab Multiplex audio, MP3) you now only need to tell BlenderDATATx where the exported/rendered video should be saved to and name your video clip...DATA DATA$(  In the Output tab (on the left):DATAx  DATA,  click the folder icon next to /tmp/ ...DATA DATAP0  (If you don't see it: press the Home button on your keyboard or MMB-click -DATAPx Middle Mouse Button, OS X Alt-click - and move the Render buttons window a bitDATA to the right...)DATA DATAL(  ... like before, when importing media, the "File Browser" comes up. If youDATAP previously imported video you can now use the small pull down menu under the PDATA$  button to quickly find your folder.DATAp DATAL  Once the path is set (e.g.: home/User/Name/Desktop or similar) type a nameDATAP for your video (e.g.: Test_) in the second row and click SELECT OUTPUT PICTURESDATAP or hit Return (twice)... (Or Esc to exit the "File Browser"/no changes made...)DATA DATAPH  Avoid using special characters (like Umlaute, cedille etc.) as well as veryDATAP long file/folder names - this can cause problems with (.blend) files not savingDATADH or opening. (Solution: rename files, use shorter folders names...)DATA  DATA DATAD  *) See also "True NTSC and 24p-support" in "Sequencer changes":DATA  DATAL  www.blender.org/development/release-logs/blender-246/sequencer-changes/DATA0  DATA`  DATAH  **) For free and open audio (Ogg Vorbis) and video (Theora) encoding:DATA  DATA8  www.xiph.orgDATAx DATAT --------------------------------------------------------------------------------DATAP(  Before exporting media set path and file name for the export: in the OutputDATAP tab in the Render buttons window click the top one of the two folder icons toDATA ( access the "File Browser"...DATATx --------------------------------------------------------------------------------DATA DATAL(  4) Click ANIM to render/export the video to your project folder. Press EscDATA to abort/stop at any time.DATA DATAT --------------------------------------------------------------------------------DATAD  Click ANIM to render/export a video sequence - it will be *savedDATA< automatically* to the folder that you previously selected.DATATp --------------------------------------------------------------------------------DATA DDATAP   Tip: if the render window does not show up after you pressed ANIM hit Esc toDATAP abort and press ANIM once more: the render window will then be in the front andDATA  not hidden behind...D DATAh ansDATA DATA +++++++++++++++++++++++++DATA +++ Questions/Answers +++7CDATAX +++++++++++++++++++++++++EEDATA DATA4 * Where can I learn more about the Blender VSE...?DATA0 DATA`  See the Blender Wiki: DATA REEDATA<  wiki.blender.org/index.php/Manual/Video_Sequence_EditingDATA@ DATALp  A good starting point - *recommended* to learn about some of the (current)DATAH *limitations* of the VSE (Blender *2.48a*) and possible *workarounds*:DATA`  DATA0   wiki.blender.org/index.php/Manual/Using_VSEDATA  DATA  DATA$P  * How can I fade-in/fade-out video?DATA  DATAH   Space to Add a Color Generator, place it above the video clip (e.g. onDATATH  Channel 2), change the colour from grey to black via Sequencer buttons > EffectsDATA$  tab (click the coloured field)...DATA  < DATA H   > fade-in:DATA  DATA,   (RMB) select *first* the *black* strip andDATA   then while holding Shift DATALP   (RMB) select the video clip (Shift adds the video clip to the selection)DATA  DATA   then:DATA0 DATA0`  Space to Add Cross and place it on Channel 3DATA DATA  < fade-out:DATA0 DATA`  *first* select the *video*DATA  etc.DATA V DATA DATA@ * How can I scrub audio?DATA DATA$  F10 > Sound block buttons > ScrubDATA DNADATA48  (Scrub is on for *this preset* (as of v0.1.1).)icDATA 2]DATA valDATA( * How can I export video with sound?slDATAP rlDATA4  F10 > Render buttons > Audio tab > Multiplex audioDATA ayeDATA@  (Multiplex audio is selected in *this preset* (as of v0.1.1).)DATA teDATAL  Also: Render buttons > Format > FFMpeg... then make your selection in the)DATA Video tab...DATAh t_aDATA(P  For more help with export settings: DATA shDATA4   wiki.blender.org/index.php/Manual/Output_FormatsrDATA actDATAH  If FFMpeg gives you problems also search the Blender Artists Forums:aDATA( eYDATA  blenderartists.org/forum/DATA`  DATAH  *Tip*: make sure to *test* FFMpeg exported/multiplexed videos in allηDATALH important media players *and* on all platforms that you are targeting forDATALs distribution...! (And feel free to blame software patents for this mess...)DATA *tDATAL`  The MPEG-4/MP3 settings in *this preset* should export video (with sound) DATALC that can be played back on all platforms *at least* when using the free andDATA open-source VLC:EEDATAX EEDATA(  www.videolan.orgEEDATA tDATA eshDATA, * How can I create a slow motion effect?dsDATAX useDATAP  Select the video clip, Space to Add Speed Control, place it above the clip.facDATA ss_DATAP8  E.g. for a fit to fill like use: G-grab the clip's end to extend it as longexpDATAD as desired (the Speed Control strip gets adjusted automatically).vDATA( evDATA$X  You can also combine this with:24]DATA aceDATA4  - make sure that Speed Control is selected... -pvDATA8 [2]DATA(h  F10 > Sequencer buttons > Effect tabenDATA fieDATA,  E.g. set Global Speed from 1.000 to 0.500.DATAH grpDATA8x  See the Blender Wiki for more Speed Control options...DATA invDATA *cuDATA$@ * How can I fade-in/fade-out audio?DATA medDATA$  Open an "Ipo Curve Editor" window:DATA  DATAP@  E.g. in the "Buttons Window" (bottom of this file) click the larger icon onnsfDATA, the top left and select "Ipo Curve Editor".DATA [3]DATALH  Check that Sequence is selected as the "Ipo type" (it is selected in *thisDATA  preset*).amDATA rpDATA$(  In the timeline select the audio.DATAx _CLDATAH  In the "Ipo Curve Editor": LMB-*Ctrl* click to set your points for theDATAL  fade-in/fade-out: the darker line/border in the "Ipo Curve Editor" windowbDATAL  represents the length of the audio clip (horizontally) and the sound leveliDATA! (vertically)...DATAP! IniDATAP!  Press Tab to enter Edit Mode and e.g. change the curve from Bezier to LinearceDATAP" via the Point menu > Interpolation mode. RMB-click to select individual points,DATAT" G-grab to move them or press Shift S for e.g. Snap to Current Frame and/or pressxaDATA<# G and then Y (= Y-axis) to move a point only vertically...bDATAh# rmsDATAL#  N for the Transform Properties widget for more precise curve adjustment...DATAL$ View menu > View All (Home) if you get lost inside the "Ipo Curve Editor".dDATA$ triDATAP8  For a free and open-source tool *specialised* in audio mixing have a look atηDATA(8% Ardour (has timecode synchronisation):sDATA% YF_DATA P  ardour.orgDATA etDATA etDATAX& * How can I make titles?ol[DATA& ][3DATAL&  Have a look at the "2D Title Presets" tutorial/.blend (same author as thisDATAH' tutorial/.blend):n_DATA' skgDATA$'  indiworks.wordpress.com/tutorials/DATA( teDATA8( nt[DATA(h( * How can I configure the interface?esDATA( bloDATAL(  E.g. add Blender's "other" timeline by splitting an existing window in twoDATAPh) and change one of them in the "Timeline" that offers more features for MarkersgDATAP) and has a playback/pause button and more. (The timeline underneath is actuallyDATATh* called "Sequence" (window) in the Blender menus and the official documentation!)locDATA* diDATA@+  How-to add the "Timeline" under the "Image Preview" window:psDATA+ penDATAL+  Place the cursor on the side of the "Image Preview" window (top right indDATAL0, this file) until you see an arrow (or a hand) and then RMB-click and selectDATA,, Split Area (and LMB-click to confirm)...setDATA- m[4DATAL0-  ...move the horizontal line that comes up towards the lower part of thectiDATAD- "Image Preview" window and LMB-click to split the window in two.4]DATA. xc[DATALH.  At the bottom left of the newly created (smaller) window select the WindowDATA$. type "Timeline" (the clock symbol).DATA/ lflDATAL@/  To further adjust the windows e.g. place the cursor at the bottom of theunDATAP/ "Image Preview" window until you see the arrow (or hand) and LMB-click and dragDATAPE the window down until you only see the "Timeline's" buttons etc. - click thetorDATAP small triangle next to the clock symbol if you can't see all the new buttons...DATA0 r[8DATA<0  For more see also the "Blender 3D: Noob to Pro" Wikibook:DATA@1 ockDATAHp1  en.wikibooks.org/wiki/Blender_3D:_Noob_to_Pro/Blender_Windowing_SystemDATA1 taDATA2 datDATALH2 * I'm using a notebook - does Blender work without having number pad keys?eDATA2 DisDATAP2  Move the cursor above this text - between text window and the menu above...teDATAPp3 Once you see an arrow (or a hand) LMB-click and pull down: System & OpenGL >edDATA3 Emulate NumpaddDATA04 tliDATA`4 ramDATAT4 --------------------------------------------------------------------------------locDATAT5 --------------------------------------------------------------------------------boDATAH5  Once familiar with the basics make sure to explore some of the otherpiDATAL6 features like Markers, Metastrips, Blend Mode, Color Balance (3-way colorilDATAD6 correction) or Histogram/Chroma Vectorscope/Luma Waveform etc...ghDATA6 al_DATAL 7  Other Blender (not VSE specific) features of interest for video post/SFXagDATAT7 works: Compositing Nodes, U/V Image Editor and the particle system, also see theterDATAD8 Stamp tab (a render option) for overlaying e.g. time information...DATAT8 --------------------------------------------------------------------------------ndDATAT9 -------------------------------------------------------------------------------- w_DATA9 *toDATA9 )()DATA9 *About*DATA : ]bDATA P:  DISCLAIMERDATA: le[DATAH:  This tutorial/.blend file is provided "as is" and no guarantee for anyDATA80; usefulness is given. Use it *only* at your own risk!epDATA; mbDATA; pliDATA ;  CREDITSsefDATA0< chDATAL`<  Tutorial by indiworks, indiworks.wordpess.com - CC 2008 (v0.1.1, November_DATA< 2008)hiDATA= taDATA@= uraDATAp=  LICENSE (tutorial)DATA= elfDATA@=  This *tutorial*/.blend is licensed under a Creative CommonsongDATA@P> Attribution-Noncommercial-No Derivative Works 3.0 license. SeevDATA<> creativecommons.org/licenses/by-nc-nd/3.0/ for the details.DATA(? aBaDATAHX?  This allows you to make copies/share/host this tutorial as long as:loaDATA? MulDATAH@  * it remains in its *original* status - download a *fresh copy* via:ifDATA$x@  indiworks.wordpress.com/tutorials/DATA<@  * you give the author credit by e.g. linking (link above)eDATA 0A  * distribute it free of chargeDATAA tBoDATALA  YOU MAY STILL USE THIS .BLEND AS A STARTING POINT FOR YOUR OWN COMMERCIALDATAL(B BLENDER MADE PROJECTS! Simply remove this "Quick Start" text file once notiDATAPB needed any more and save the .blend under another name - at the latest beforetDATA< C you share a modified version of this .blend with others!EleDATAC eVaDATALC  One reason for the restrictions: to make it easy for the author to updateoDATA@0D the tutorial - multiple versions simply can not be supported...DATAD ctuDATALD  If you are an educator, teacher or trainer YOU MAY USE THIS TUTORIAL AS AeDATAHHE TEACHING AID in your classes (film school, multimedia training or fornsDATALE instructing employees in your company), you may also distribute it to yourdDATAL8F students (but only free of charge, unaltered etc. as stated in the licenseNDATATF text). What you may *not* do is e.g. charge money for a one day training that isNodDATAP0G only based on this tutorial or bundle the tutorial with a commercial productleEDATAPG like a training manual/book or magazine without prior getting permission to doDATA0H so...DATAhH XDATAH DATATH --------------------------------------------------------------------------------DATA HI Change LogDATAI  DATAI * v0.1 (July 2008)DATAI DATA J Initial release. DATA`J [DATAJ DATAJ * v0.1.1 (November 2008)DATAK DATA08K Correction: "*Space* > Movie = to add video"DATAK DATA(K *New*: "More" ("Editing/VSE Basics")DATA L DATA4PL Series of smaller additions, some minor rewriting.DATAL EDATAL Minor corrections.DATA M wDATAPM Minor layout changes.DATAM DATA8M Render settings changed. (See "Export Media" for more.)DATAT0N --------------------------------------------------------------------------------DATAN DATAN DATATO --------------------------------------------------------------------------------+DATATO --------------------------------------------------------------------------------DATALP  Share the original tutorial/.blend and help promoting the Blender VideoJDATATP Sequence Editor: since Blender works under FreeBSD, GNU/Linux, OS X, Solaris andDATALQ Windows the Blender VSE brings free and open-source (and de facto platformDATAPQ independent - .blends can be shared) non-linear video editing to almost any PCDATAPR that an editor, video artist, company or organisation might be using or couldDATAPR set up at virtually no cost: the Blender VSE also works on older hardware (e.g.DATAS with Ubuntu). DATAT@S --------------------------------------------------------------------------------DATATS -------------------------------------------------------------------------------- OBHpX p[ OBCameraamera.001 a ne@>N@???*?91<"P?ޕ/?5F:?81V~>75e?'?T3>ne@>N@??????}g3² B3?ș3 ~~2?43??14t?!E3IC3aj1?@4'5?OBd8?)d??>)d?u=?????OBH[ p_ pX OBCubephere g `_ ???????????????ޕ/?4F:?81V~>85e?'?T2>ne@>M@?DOBd8? #=?>=u=???@???h DATA`_ OBH_ p[ OBLamp b p@?p@???{&?W+b=?6씾t? bfE9L"?%?_>oK?p@?p@??????#1n12?~2Nj`?Pr?5씾fE%?t?9L_> b"?oK? ?Af ?DOBd8? #=?>=u=??@???MAlc *MAMaterialL?L?L???????????L?????2?? ף; ף;? ?????????@?=?==???e Xf ????L?L?L?L==ff????DATAe !f ??????????L>DATA Xf TEf &TETex>@???????@@????? @??<MEg 4MECubephere i o j l Pi k  m  3???DATA i c DATA,Pi 'j DATAj :??II?I?I???III??II?I??IIDATA,k 'l DATAl 7 ############DATA,m 'o DATAxo 6DNA1̩(z SDNANAMEE *next*prev*data*first*lastxyzwxminxmaxyminymax*pointergroupvalval2name[32]typesubtypeflagsaveddatalentotallen*newid*libname[24]usicon_id*propertiesid*idblock*filedataname[240]filename[240]totpad*parentw[2]h[2]changed[2]pad0pad1*rect[2]*obblocktypeadrcodename[128]*bp*beztmaxrcttotrctvartypetotvertipoextraprtbitmaskslide_minslide_maxcurval*drivercurvecurshowkeymuteipoposrelativetotelempad2*weightsvgroup[32]sliderminslidermax*refkeyelemstr[32]elemsizeblock*ipo*fromtotkeyslurph**scripts*flagactscripttotscript*line*formatblenlinenostartendflagscolor[4]pad[4]*namenlineslines*curl*sellcurcselcmarkers*undo_bufundo_posundo_len*compiledmtimesizeseekpassepartalphaangleclipstaclipendlensortho_scaledrawsizeshiftxshiftyYF_dofdistYF_apertureYF_bkhtypeYF_bkhbiasYF_bkhrotscriptlink*dof_obframenrframesoffsetsfrafie_imacyclokmulti_indexlayerpassmenunribufs*gputexture*anim*rrsourcelastframetpageflagtotbindxrepyreptwstatwendbindcode*repbind*packedfile*previewlastupdatelastusedanimspeedgen_xgen_ygen_typeaspxaspy*vnodetexcomaptomaptonegblendtype*object*texuvname[32]projxprojyprojzmappingofs[3]size[3]texflagcolormodelpmaptopmaptonegnormapspacepad[3]rgbkdef_varcolfacnorfacvarfacdispfacwarpfacname[160]*handle*pname*stnamesstypesvars*varstr*result*cfradata[32](*doit)()(*instance_init)()(*callback)()versionaipotype*ima*cube[6]imat[4][4]obimat[3][3]stypeviewscalenotlaycuberesdepthrecalclastsizenoisesizeturbulbrightcontrastrfacgfacbfacfiltersizemg_Hmg_lacunaritymg_octavesmg_offsetmg_gaindist_amountns_outscalevn_w1vn_w2vn_w3vn_w4vn_mexpvn_distmvn_coltypenoisedepthnoisetypenoisebasisnoisebasis2imaflagcropxmincropymincropxmaxcropymaxxrepeatyrepeatextendcheckerdistnablaiuser*plugin*coba*envloc[3]rot[3]mat[4][4]min[3]max[3]pad3modetotexshdwrshdwgshdwbshdwpadenergydistspotsizespotblendhaintatt1att2*curfallofffalloff_typeshadspotsizebiassoftbufsizesampbuffersfiltertypebufflagbuftyperay_sampray_sampyray_sampzray_samp_typearea_shapearea_sizearea_sizeyarea_sizezadapt_threshray_samp_methodtexactshadhalostepsun_effect_typeskyblendtypehorizon_brightnessspreadsun_brightnesssun_sizebackscattered_lightsun_intensityatm_turbidityatm_inscattering_factoratm_extinction_factoratm_distance_factorskyblendfacsky_exposuresky_colorspacepad4YF_numphotonsYF_numsearchYF_phdepthYF_useqmcYF_bufsizeYF_padYF_causticblurYF_ltradiusYF_glowintYF_glowofsYF_glowtypeYF_pad2*mtex[18]specrspecgspecbmirrmirgmirbambrambbambgambemitangspectraray_mirroralpharefspeczoffsaddtranslucencyfresnel_mirfresnel_mir_ifresnel_trafresnel_tra_ifiltertx_limittx_falloffray_depthray_depth_traharseed1seed2gloss_mirgloss_trasamp_gloss_mirsamp_gloss_traadapt_thresh_miradapt_thresh_traaniso_gloss_mirdist_mirfadeto_mirshade_flagmode_lflarecstarclinecringchasizeflaresizesubsizeflarebooststrand_stastrand_endstrand_easestrand_surfnorstrand_minstrand_widthfadestrand_uvname[32]sbiaslbiasshad_alphaseptexrgbselpr_typeuse_nodespr_backpr_lampml_flagdiff_shaderspec_shaderroughnessrefracparam[4]rmsdarkness*ramp_col*ramp_specrampin_colrampin_specrampblend_colrampblend_specramp_showrampfac_colrampfac_spec*nodetree*groupfrictionfhreflectfhdistxyfrictdynamodesss_radius[3]sss_col[3]sss_errorsss_scalesss_iorsss_colfacsss_texfacsss_frontsss_backsss_flagsss_presetYF_arYF_agYF_abYF_dscaleYF_dpwrYF_dsmpYF_presetYF_djitgpumaterialname[256]scale*bbi1j1k1i2j2k2selcol1selcol2quat[4]expxexpyexpzradrad2s*mat*imatelemsdisp**mattotcolwiresizerendersizethreshvec[3][3]alfaweightradiush1h2f1f2f3hidevec[4]mat_nrpntsupntsvresoluresolvorderuordervflaguflagv*knotsu*knotsvtilt_interpradius_interpcharidxkernhnurb*bevobj*taperobj*textoncurve*path*keybevpathlenbevresolwidthext1ext2resolu_renresolv_renspacemodespacinglinedistshearfsizewordspaceulposulheightxofyoflinewidth*strfamily[24]*vfont*vfontb*vfonti*vfontbisepchartotboxactbox*tbselstartselend*strinfocurinfoeffect*mface*mtface*tface*mvert*medge*dvert*mcol*msticky*texcomesh*mselectvdataedatafdatatotedgetotfacetotselectact_facecubemapsizesmoothreshsubdivsubdivrsubsurftype*mr*pv*tpageuv[4][2]col[4]transptileunwrapv1v2v3v4edcodecreasebweightdef_nr*dwtotweightco[3]no[3]uv[2]co[2]indexfis[256]v[4]midpad[2]v[2]*faces*colfaces*edges*edge_boundary_states*vert_edge_map*vert_face_map*map_mem*vertslevelslevel_countcurrentnewlvledgelvlpinlvlrenderlvluse_col*edge_flags*edge_creases*vert_map*edge_map*old_faces*old_edges*errormodifiersubdivTyperenderLevels*emCache*mCachedefaxispad[6]lengthrandomizeseed*ob_arm*start_cap*end_cap*curve_ob*offset_oboffset[3]scale[3]merge_distfit_typeoffset_typecountaxistolerance*mirror_obsplit_anglevalueresval_flagslim_flagse_flagsbevel_angledefgrp_name[32]*texturestrengthdirectionmidleveltexmapping*map_objectuvlayer_name[32]uvlayer_tmp*projectors[10]*imagenum_projectorsaspectxaspectypercentfaceCountfacrepeat*objectcenterstartxstartyheightnarrowspeeddampfallofftimeoffslifetimedeformflagmulti*prevCosparentinv[4][4]cent[3]*indexartotindexforce*clothObject*sim_parms*coll_parms*point_cache*x*xnew*xold*current_xnew*current_x*current_v*mfacesnumvertsnumfacesabsorptiontime*bvhtreeoperationvertextotinfluencegridsizeneedbind*bindweights*bindcostotcagevert*dyngrid*dyninfluences*dynverts*pad2dyngridsizedyncellmin[3]dyncellwidthbindmat[4][4]*psys*dmtotdmverttotdmedgetotdmfacepsysrt[2]*facepavgroupprotect*fss*target*auxTargetvgroup_name[32]keepDistshrinkTypeshrinkOptsprojAxissubsurfLevels*originfactorlimit[2]originOptspntswopntsuopntsvopntswtypeutypevtypewfufvfwdudvdw*defvec[8][3]partypepar1par2par3parsubstr[32]*track*proxy*proxy_group*proxy_from*action*poselib*poseconstraintChannelsdefbasemodifiersdloc[3]orig[3]dsize[3]drot[3]obmat[4][4]constinv[4][4]laycolbitstransflagipoflagtrackflagupflagnlaflagprotectflagipowinscaflagscavisflagboundtypedupondupoffdupstadupendsfctimemassdampinginertiaformfactorrdampingsizefacmargindtdtxactcolempty_drawtypepad1[3]empty_drawsizedupfacescapropsensorscontrollersactuatorsbbsize[3]actdefgameflaggameflag2*bsoftsoftflaganisotropicFriction[3]constraintsnlastripshooksparticlesystem*pd*soft*dup_groupfluidsimFlagrestrictflagshapenrshapeflagrecalcobody_type*fluidsimSettings*derivedDeform*derivedFinallastDataMaskstateinit_stategpulampcurindexactivedeflectforcefieldpdef_damppdef_rdamppdef_permpdef_frictpdef_rfrictf_strengthf_powerf_distf_dampmaxdistmindistmaxradminradf_power_rpdef_sbdamppdef_sbiftpdef_sboftclump_facclump_powkink_freqkink_shapekink_ampfree_endtex_nablatex_modekinkkink_axisrt2*rngf_noisesimframestartframeendframeeditframelinStiffangStiffvolumeviterationspiterationsditerationsciterationskSRHR_CLkSKHR_CLkSSHR_CLkSR_SPLT_CLkSK_SPLT_CLkSS_SPLT_CLkVCFkDPkDGkLFkPRkVCkDFkMTkCHRkKHRkSHRkAHRcollisionflagsnumclusteriterations*particlestotpointtotspring*bpoint*bspringnodemassgravmediafrictrklimitphysics_speedgoalspringgoalfrictmingoalmaxgoaldefgoalvertgroupfuzzynessinspringinfrictefraintervallocalsolverflags**keystotpointkeysecondspringcolballballdampballstiffsbc_modeaeroedgeminloopsmaxloopschokesolver_IDplasticspringpreload*scratchshearstiffinpush*pointcacheshow_advancedoptionsresolutionxyzpreviewresxyzrealsizeguiDisplayModerenderDisplayModeviscosityValueviscosityModeviscosityExponentgravxgravygravzanimStartanimEndgstarmaxRefineiniVelxiniVelyiniVelz*orgMesh*meshSurface*meshBBsurfdataPath[240]bbStart[3]bbSize[3]typeFlagsdomainNovecgenvolumeInitTypepartSlipValuegenerateTracersgenerateParticlessurfaceSmoothingsurfaceSubdivsparticleInfSizeparticleInfAlphafarFieldSize*meshSurfNormalscpsTimeStartcpsTimeEndcpsQualityattractforceStrengthattractforceRadiusvelocityforceStrengthvelocityforceRadiuslastgoodframemistypehorrhorghorbhorkzenrzengzenbzenkambkfastcolexposureexprangelinfaclogfacgravityactivityBoxRadiusskytypephysicsEnginemisimiststamistdistmisthistarrstargstarbstarkstarsizestarmindiststardiststarcolnoisedofstadofenddofmindofmaxaodistaodistfacaoenergyaobiasaomodeaosampaomixaocolorao_adapt_threshao_adapt_speed_facao_approx_errorao_approx_correctionao_samp_methodao_gather_methodao_approx_passes*aosphere*aotableshemiresmaxiterdrawtypesubshootpsubshootenodelimmaxsublamppamapamielmaelmimaxnodeconvergenceradfacgammaselcolsxsy*lpFormat*lpParmscbFormatcbParmsfccTypefccHandlerdwKeyFrameEverydwQualitydwBytesPerSeconddwFlagsdwInterleaveEveryavicodecname[128]*cdParms*padcdSizeqtcodecname[128]codecaudio_codecvideo_bitrateaudio_bitrategop_sizerc_min_raterc_max_raterc_buffer_sizemux_packet_sizemux_ratemixratemain*mat_override*light_overridelay_zmasklayflagpassflagpass_xor*avicodecdata*qtcodecdataffcodecdatacfrapsfrapefraimagesframaptothreadsframelenblurfacedgeRedgeGedgeBfullscreenxplayyplayfreqplayattribrt1stereomodedimensionspresetmaximsizexschyschxpartsypartswinposplanesimtypesubimtypequalityrpadrpad1rpad2scemoderendererocresalphamodeosafrs_secedgeintsafetyborderdisprectlayersactlayxaspyaspfrs_sec_basegausspostmulpostgammaposthuepostsatdither_intensitybake_osabake_filterbake_modebake_flagbake_normal_spacebake_quad_splitbake_maxdistbake_biasdistbake_padGIqualityGIcacheGImethodGIphotonsGIdirectYF_AAYFexportxmlYF_nobumpYF_clamprgbyfpad1GIdepthGIcausdepthGIpixelspersampleGIphotoncountGImixphotonsGIphotonradiusYF_raydepthYF_AApassesYF_AAsamplesyfpad2GIshadowqualityGIrefinementGIpowerGIindirpowerYF_gammaYF_exposureYF_raybiasYF_AApixelsizeYF_AAthresholdbackbuf[160]pic[160]stampstamp_font_idstamp_udata[160]fg_stamp[4]bg_stamp[4]simplify_subsurfsimplify_shadowsamplessimplify_particlessimplify_aossscineonwhitecineonblackcineongammaparticle_percsubsurf_maxshadbufsample_maxao_errorcol[3]framename[64]*brushtoolstepinverttotrekeytotaddkeybrushtypebrush[7]emitterdistdraw_timedname[36]mat[3][3]cornertypeeditbutflagjointrilimitdegrturnextr_offsdoublimitsegmentsringsverticesunwrapperuvcalc_radiusuvcalc_cubesizeuvcalc_mapdiruvcalc_mapalignuvcalc_flagautoik_chainlenimapaintparticleselect_threshclean_threshretopo_moderetopo_paint_toolline_divellipse_divretopo_hotspotmultires_subdiv_typeskgen_resolutionskgen_threshold_internalskgen_threshold_externalskgen_length_ratioskgen_length_limitskgen_angle_limitskgen_correlation_limitskgen_symmetry_limitskgen_optionsskgen_postproskgen_postpro_passesskgen_subdivisions[3]edge_modepad3[4]dirview*session*cumapdrawbrushsmoothbrushpinchbrushinflatebrushgrabbrushlayerbrushflattenbrushpivot[3]brush_typetexnrtexrepttexfadetexsepaveragingtablet_sizetablet_strengthsymmrakeaxislock*camera*world*setbase*basactcursor[3]twcent[3]twmin[3]twmax[3]editbutsizeselectmodeproportionalprop_modeautomergepad5pad6autokey_mode*ed*radioframing*toolsettingsaudiotransform_spacesjumpframesnap_modesnap_flagsnap_target*theDagdagisvaliddagflagssculptdataframe_stepzoomblendximyimspacetypeblockscale*areablockhandler[8]viewmat[4][4]viewinv[4][4]persmat[4][4]persinv[4][4]winmat1[4][4]viewmat1[4][4]viewquat[4]zfaclay_usedpersp*ob_centre*bgpic*localvd*ri*retopo_view_data*depthsob_centre_bone[32]localviewlayactscenelockaroundcamzoompivot_lastgridgridviewpixsizenearfarcamdxcamdygridlinesviewbutgridflagmodeselecttwtypetwmodetwflagtwdrawflagtwmat[4][4]clip[4][4]*clipbbafterdrawzbufxrayflag2gridsubdivkeyflagsndofmodendoffilter*properties_storage*gpdlviewquat[4]lpersplviewverthormaskmin[2]max[2]minzoommaxzoomscrollkeeptotkeepaspectkeepzoomoldwinxoldwinycursor[2]rowbutv2d*editipoipokeyactname[32]constname[32]bonename[32]totipopinbutofschannellockmedian[3]cursenscuractaligntabomainbmainbo*lockpointexfromshowgroupmodeltypescriptblockre_alignoldkeypresstab[7]chanshownzebra*filelisttotfiletitle[24]dir[240]file[80]ofssortmaxnamelencollumsf_fpfp_str[8]*libfiledataretvalmenuact(*returnfunc)()(*returnfunc_event)()(*returnfunc_args)()*arg1*arg2*menup*pupmenuoopsvisiflagtree*treestoresearch_string[32]search_tsesearch_flagsdo_outlinevisstoreflagdeps_flagsimanrcurtileimtypenrdt_uvstickydt_uvstretchpad[5]centxcentyautosnap*texttopviewlinesfont_idlheightleftshowlinenrstabnumbercurrtab_setshowsyntaxoverwritepix_per_linetxtscrolltxtbarwordwrapdoplugins*py_draw*py_event*py_button*py_browsercallback*py_globaldictlastspacescriptname[256]scriptarg[256]*script*but_refsredraws*idaspect*curfont*edittreetreetype*filesactive_filenumtilesxnumtilesyselstateviewrectbookmarkrectscrollposscrollheightscrollareaactive_bookmarkprv_wprv_h*imgoutline[4]neutral[4]action[4]setting[4]setting1[4]setting2[4]num[4]textfield[4]textfield_hi[4]popup[4]text[4]text_hi[4]menu_back[4]menu_item[4]menu_hilite[4]menu_text[4]menu_text_hi[4]but_drawtypeiconfile[80]back[4]header[4]panel[4]shade1[4]shade2[4]hilite[4]grid[4]wire[4]select[4]lamp[4]active[4]group[4]group_active[4]transform[4]vertex[4]vertex_select[4]edge[4]edge_select[4]edge_seam[4]edge_sharp[4]edge_facesel[4]face[4]face_select[4]face_dot[4]normal[4]bone_solid[4]bone_pose[4]strip[4]strip_select[4]cframe[4]vertex_sizefacedot_sizebpad[2]syntaxl[4]syntaxn[4]syntaxb[4]syntaxv[4]syntaxc[4]movie[4]image[4]scene[4]audio[4]effect[4]plugin[4]transition[4]meta[4]editmesh_active[4]handle_vertex[4]handle_vertex_select[4]handle_vertex_sizehpad[7]solid[4]tuitbutstv3dtfiletipotinfotsndtacttnlatseqtimatimaseltexttoopsttimetnodetarm[20]bpad[4]bpad1[4]spec[4]dupflagsavetimetempdir[160]fontdir[160]renderdir[160]textudir[160]plugtexdir[160]plugseqdir[160]pythondir[160]sounddir[160]yfexportdir[160]versionsvrmlflaggameflagswheellinescrolluiflaglanguageuserprefviewzoomconsole_bufferconsole_outmixbufsizefontsizeencodingtransoptsmenuthreshold1menuthreshold2fontname[256]themesundostepsundomemorygp_manhattendistgp_euclideandistgp_erasergp_settingstb_leftmousetb_rightmouselight[3]tw_hotspottw_flagtw_handlesizetw_sizetextimeouttexcollectratememcachelimitprefetchframesframeserverportpad_rot_angleobcenter_diarvisizervibrightrecent_filessmooth_viewtxglreslimitndof_panndof_rotatecurssizepad[8]versemaster[160]verseuser[160]glalphaclipautokey_flagcoba_weightvertbaseedgebaseareabase*sceneendxendysizexsizeyscenenrscreennrfullmainwinwinakthandler[8]*newvvec*v1*v2panelname[64]tabname[64]drawname[64]ofsxofsycontrolsnapold_ofsxold_ofsysortcounter*paneltab*v3*v4*fullwinmat[4][4]headrctwinrctheadwinwinheadertypebutspacetypewinxwinyhead_swaphead_equalwin_swapwin_equalheadbutlenheadbutofscursorspacedatauiblockspanelssubvstr[4]subversionpadsminversionminsubversiondisplaymode*curscreen*curscenefileflagsglobalfname[80]*ibuf*ibuf_comp*se1*se2*se3nrbottomrightxofsyofslift[3]gamma[3]gain[3]saturationdir[160]donestartstillendstill*stripdataorxory*crop*transform*color_balance*tstripdata*tstripdata_startstill*tstripdata_endstill*ibuf_startstill*ibuf_endstill*instance_private_data**current_private_data*tmpstartofsendofsmachinestartdispenddispmulhandsizeanim_preseek*stripfacf0facf1*seq1*seq2*seq3seqbase*sound*hdaudiolevelpancurposstrobe*effectdataanim_startofsanim_endofsblend_modeblend_opacity*oldbasep*parseq*seqbasepmetastackedgeWidthforwardwipetypefMinifClampfBoostdDistdQualitybNoCompScalexIniScaleyIniScalexFinScaleyFinxInixFinyIniyFinrotInirotFininterpolation*frameMapglobalSpeedlastValidFramebuttypeuserjitstatotpartnormfacobfacrandfactexfacrandlifeforce[3]vectsizemaxlendefvec[3]mult[4]life[4]child[4]mat[4]texmapcurmultstaticstepomattimetexspeedtexflag2negvertgroup_vvgroupname[32]vgroupname_v[32]*keysminfacusedusedelemdxdylinkotypeold*poin*oldpoinresetdistlastval*makeyqualqual2targetName[32]toggleName[32]value[32]maxvalue[32]delaydurationmaterialName[32]damptimerpropname[32]matname[32]axisflag*fromObjectsubject[32]body[32]pulsefreqtotlinks**linksjoyindexaxisfbuttonhathatfprecisionstr[128]*mynewinputstotslinks**slinksvalostate_mask*actframeProp[32]blendinpriorityend_resetstrideaxisstridelengthsndnrpad1[2]makecopycopymadepad2[1]track*melinVelocity[3]angVelocity[3]localflagdyn_operationforceloc[3]forcerot[3]linearvelocity[3]angularvelocity[3]butstabutendminmaxvisifacrotdampminloc[3]maxloc[3]minrot[3]maxrot[3]matprop[32]distributionint_arg_1int_arg_2float_arg_1float_arg_2toPropName[32]*toObjectbodyTypefilename[64]loadaniname[64]int_argfloat_arggoaccellerationmaxspeedmaxrotspeedmaxtiltspeedtiltdampspeeddamp*sample*stream*newpackedfile*snd_soundpanningattenuationpitchmin_gainmax_gaindistancestreamlenchannelshighpriopad[10]gaindopplerfactordopplervelocitynumsoundsblendernumsoundsgameengine*lamprengobjectdupli_ofs[3]childbaserollhead[3]tail[3]bone_mat[3][3]arm_head[3]arm_tail[3]arm_mat[4][4]xwidthzwidthease1ease2rad_headrad_tailbonebasechainbasepathflaglayer_protectedghostepghostsizeghosttypepathsizeghostsfghostefpathsfpathefpathbcpathacconstflagikflagselectflagagrp_index*bone*childiktree*b_bone_mats*dual_quat*b_bone_dual_quatschan_mat[4][4]pose_mat[4][4]pose_head[3]pose_tail[3]limitmin[3]limitmax[3]stiffness[3]ikstretch*customchanbaseproxy_layerstride_offset[3]cyclic_offset[3]agroupsactive_groupcustomColcs*grpreserved1groupsactive_markeractnractwidthtimeslidename[30]ownspacetarspaceenforceheadtail*tarsubtarget[32]matrix[4][4]space*proptarnumtargetsiterationsrootbonemax_rootbone*poletarpolesubtarget[32]poleangleorientweightgrabtarget[3]reserved2minmaxflagstuckcache[3]lockflagfollowflagvolmodeplaneorglengthbulgepivXpivYpivZaxXaxYaxZminLimit[6]maxLimit[6]extraFzinvmat[4][4]fromtomap[3]expofrom_min[3]from_max[3]to_min[3]to_max[3]zminzmaxchannel[32]no_rot_axisstride_axiscurmodactstartactendactoffsstridelenblendoutstridechannel[32]offs_bone[32]hasinputhasoutputdatatypesockettype*new_socknslimitstack_indexinternstack_index_extlocxlocyown_indexto_index*tosock*link*new_nodeusername[32]lastyoutputs*storageminiwidthcustom1custom2need_execexectotrbutrprvr*typeinfo*fromnode*tonode*fromsocknodeslinks*stack*threadstackinitstacksizecur_indexalltypes*owntype*selin*selout(*timecursor)()(*stats_draw)()(*test_break)()cyclicmoviesamplesminspeedpercentxpercentybokehcurvedimage_in_widthimage_in_heightcenter_xcenter_yspiniterwrapsigma_colorsigma_spacehuesatt1t2t3fstrengthfalphakey[4]x1x2y1y2colname[32]bktyperotationpreviewgamcono_zbuffstopmaxblurbthresh*dict*nodeangle_ofscolmodmixthresholdfademcjitprojfitshortymintablemaxtableext_in[2]ext_out[2]*curve*table*premultablecurrcliprcm[4]black[3]white[3]bwmul[3]sample[3]offset[2]innerradiusratergb[3]cloneactive_rnd*layerstotlayermaxlayertotsize*pooleditflagvel[3]rot[4]ave[3]numparentpa[4]w[4]fuv[4]foffsetrand[3]*stick_obprev_state*hairi_rot[4]r_rot[4]r_ave[3]r_ve[3]dietimebanksizemulnum_dmcachebpialiveloopdistrphystyperotmodeavemodereacteventdrawdraw_asdraw_sizechildtypedraw_stepren_stephair_stepkeys_stepadapt_angleadapt_pixrotfromintegratornbetweenboidneighboursbb_alignbb_uv_splitbb_animbb_split_offsetbb_tiltbb_rand_tiltbb_offset[2]simplify_flagsimplify_refsizesimplify_ratesimplify_transitionsimplify_viewporttimetweakjitfackeyed_timeeff_hairgrid_respartfactanfactanphasereactfacavefacphasefacrandrotfacrandphasefacrandsizereactshapeacc[3]dragfacbrownfacdampfacabslengthrandlengthchild_nbrren_child_nbrparentschildsizechildrandsizechildradchildflatchildspreadclumpfacclumppowrough1rough1_sizerough2rough2_sizerough2_thresrough_endrough_end_shapebranch_thresdraw_line[2]max_velmax_lat_accmax_tan_accaverage_velbankingmax_bankgroundzboidfac[8]boidrule[8]*eff_group*dup_ob*bb_ob*pd2*part*edit**pathcache**childcachepathcachebufschildcachebufs*target_ob*keyed_ob*latticeeffectorsreacteventstotchildtotcachedtotchildcachetarget_psyskeyed_psystotkeyedbakespacebb_uvname[3][32]vgroup[12]vg_negrt3*renderdata*cacheCdisCvi[3]structuralbendingmax_bendmax_structmax_shearavg_spring_lentimescaleeff_force_scaleeff_wind_scalesim_time_oldstepsPerFrameprerollmaxspringlensolver_typevgroup_bendvgroup_massvgroup_structpresets*collision_listepsilonself_frictionselfepsilonself_loop_countloop_countpressure*pointstotpointsthicknessstrokesframenum*actframegstepinfo[128]sbuffer_sizesbuffer_sflag*sbufferTYPE_charucharshortushortintlongulongfloatdoublevoidLinkLinkDataListBasevec2svec2ivec2fvec2dvec3ivec3fvec3dvec4ivec4fvec4drctirctfIDPropertyDataIDPropertyIDLibraryFileDataPreviewImageIpoDriverObjectIpoCurveBPointBezTripleIpoKeyBlockKeyScriptLinkTextLineTextMarkerTextPackedFileCameraImageUserImageGPUTextureanimRenderResultMTexTexPluginTexCBDataColorBandEnvMapImBufTexMappingLampCurveMappingWaveMaterialbNodeTreeGroupVFontVFontDataMetaElemBoundBoxMetaBallNurbCharInfoTextBoxCurvePathMeshMFaceMTFaceTFaceMVertMEdgeMDeformVertMColMStickyMSelectCustomDataMultiresPartialVisibilityMDeformWeightMTexPolyMLoopUVMLoopColMFloatPropertyMIntPropertyMStringPropertyOrigSpaceFaceMultiresColMultiresColFaceMultiresFaceMultiresEdgeMultiresLevelMultiresMapNodeModifierDataSubsurfModifierDataLatticeModifierDataCurveModifierDataBuildModifierDataMaskModifierDataArrayModifierDataMirrorModifierDataEdgeSplitModifierDataBevelModifierDataBMeshModifierDataDisplaceModifierDataUVProjectModifierDataDecimateModifierDataSmoothModifierDataCastModifierDataWaveModifierDataArmatureModifierDataHookModifierDataSoftbodyModifierDataClothModifierDataClothClothSimSettingsClothCollSettingsPointCacheCollisionModifierDataBVHTreeBooleanModifierDataMDefInfluenceMDefCellMeshDeformModifierDataParticleSystemModifierDataParticleSystemDerivedMeshParticleInstanceModifierDataExplodeModifierDataFluidsimModifierDataFluidsimSettingsShrinkwrapModifierDataSimpleDeformModifierDataLatticebDeformGroupbActionbPoseBulletSoftBodyPartDeflectSoftBodyObHookRNGSBVertexBodyPointBodySpringSBScratchWorldRadioBaseAviCodecDataQuicktimeCodecDataFFMpegCodecDataAudioDataSceneRenderLayerRenderDataRenderProfileGameFramingTimeMarkerImagePaintSettingsBrushParticleBrushDataParticleEditSettingsTransformOrientationToolSettingsBrushDataSculptDataSculptSessionSceneDagForestBGpicView3DSpaceLinkScrAreaRenderInfoRetopoViewDataViewDepthsbGPdataView2DSpaceInfoSpaceIpoSpaceButsSpaceSeqSpaceFiledirentryBlendHandleSpaceOopsTreeStoreTreeStoreElemSpaceImageSpaceNlaSpaceTextScriptSpaceScriptSpaceTimeSpaceNodeSpaceImaSelFileListThemeUIThemeSpaceThemeWireColorbThemeSolidLightUserDefbScreenScrVertScrEdgePanelFileGlobalStripElemTStripElemStripCropStripTransformStripColorBalanceStripProxyStripPluginSeqSequencebSoundhdaudioMetaStackEditingWipeVarsGlowVarsTransformVarsSolidColorVarsSpeedControlVarsEffectBuildEffPartEffParticleWaveEffOopsbPropertybNearSensorbMouseSensorbTouchSensorbKeyboardSensorbPropertySensorbActuatorSensorbDelaySensorbCollisionSensorbRadarSensorbRandomSensorbRaySensorbMessageSensorbSensorbControllerbJoystickSensorbExpressionContbPythonContbActuatorbAddObjectActuatorbActionActuatorbSoundActuatorbCDActuatorbEditObjectActuatorbSceneActuatorbPropertyActuatorbObjectActuatorbIpoActuatorbCameraActuatorbConstraintActuatorbGroupActuatorbRandomActuatorbMessageActuatorbGameActuatorbVisibilityActuatorbTwoDFilterActuatorbParentActuatorbStateActuatorFreeCamerabSamplebSoundListenerSpaceSoundGroupObjectBonebArmaturebPoseChannelbActionGroupbActionChannelSpaceActionbConstraintChannelbConstraintbConstraintTargetbPythonConstraintbKinematicConstraintbTrackToConstraintbRotateLikeConstraintbLocateLikeConstraintbMinMaxConstraintbSizeLikeConstraintbActionConstraintbLockTrackConstraintbFollowPathConstraintbStretchToConstraintbRigidBodyJointConstraintbClampToConstraintbChildOfConstraintbTransformConstraintbLocLimitConstraintbRotLimitConstraintbSizeLimitConstraintbDistLimitConstraintbActionModifierbActionStripbNodeStackbNodeSocketbNodeLinkbNodebNodePreviewbNodeTypeNodeImageAnimNodeBlurDataNodeDBlurDataNodeBilateralBlurDataNodeHueSatNodeImageFileNodeChromaNodeTwoXYsNodeTwoFloatsNodeGeometryNodeVertexColNodeDefocusNodeScriptDictNodeGlareNodeTonemapNodeLensDistCurveMapPointCurveMapBrushCloneCustomDataLayerHairKeyParticleKeyChildParticleParticleDataParticleSettingsParticleEditParticleCacheKeyLinkNodebGPDspointbGPDstrokebGPDframebGPDlayerTLEN   L4( H\$8Tpx(x T8l|LDlh88,< L   @ 84DX`D`t@<l<<\hd4Dd@L@@@<lht(T8pd(4H8P HP`<$$X P$88 x P4 088,@0,Hh(H,(lDLP<< \PLhT`<8l (DtH@,@t<h4,,D,@,4` l\4<$x( (@   ,<8HSTRC6                     !"#$%&'()*+, -./0!!!"1#234./56789  :;<=>$ ?@.AB%%%%C=/DEF GHIJ& %KLM= N$OPQR'STUV%(((WXY) ))Z[\+]^_*`]a b(c(def ghij kl+mn]% ,opqrstuvwxyz{|$O'} ~- . " /01%++ 2 394   %5C@6$@57 .8qr35-$O.4679 -:P     ;Fqr !"#$%&'()*++,-./0123456789:;<=>?@ABCDEFGH2I$O'}<$O=JKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrs tuvwxyz{|}~+<662I>$O?F'} @%A+BBBCDC  $O=# "%EEE"1#2F%FGH9C     $OI&= FbC  @ @ @ @%GFFJ'C $O&=KLMNOPQRJ S!T"T#T$6%&'()%*+,-U.V/ M 0123 45K6789%:O67;<W=PW>?N@A<QX.03 45YBZ%RCSDL1.03 45[E\F]G^1_`_2aHIJbKIcccaL`MbNO P QdR6&%%NSU TNSUVWXYZ[T"T$\]V^_K`Oa&%6%eee bfecdTe] f ggec hec hiiec[jkljec mH k ec n o p qrsjtuv]wlecxy zmec{]n ec|}%]~oec%p ec3 %q ec .]%recsectec muec 3 %+vecF w ec xecyecz{|}~ecNNNNNNK%ec %ec %6ec9ec -ecec} ec  i ec  x%F%"$O&PC% m &    $OIC      =      '} ! " # $%D&2'()*+ , - . /01?23456*789:;<=>F ? &@A$BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_3`a%}bcdefghijklmnopqrstuvwxyz{|}~,%Q}0JJJ$ONB +PRQ  +  $O2I'}     !"#$%&'(%) * +,F- ./012]3456789 =:?;<=%>?x@ABCDEFGHIJKLMNOPQRS_TUmVWXYZ[\]^_`abc defghijkl mn%opqrstuvwxyz{|}~ +F+Fm*mJ2I;+]J+ .      > '} g <% .-m !"K#$%&'()*+,-./0  123456789:;<=+s>?@ABCDEFGHIJKLMNCO PQ3RSTUVW XYZ[\ $@]^_`abcdefghij;i#$%&#$%&#$%&kFl m n$OPopqrstuA.vw$#$%4&xyz{l|s} ~ %+#$%&l|%Y!#$%&+F     #$%&l s9 ~ #$%&l.-;  vsY #$%&vl#$%&*]      ] #$%]+ #$%l#$%&lP >>%Y*#$%&l b%+     86     _ !"#$%&'%()*+,-./0123456789:%2;B<=>?@ABCDEFGHIJKLMNOPQRSTUVW XYZ[\]^_`abcdefghijklmnopqrst%uvwxy6z { | }~% k%A4#'}    [  88%988      -  [$O~0  %    %9p   %  ]j 99-\Ql% !"#$S%&'()?*+E, -. / 01% 2 345%+F=6%789:;%<=%>?%@A Fpxl>BC +D EFG0HIJ+F K -% LxMNOPQR*STJ0UF KVWX% - Y\Z[\]^_ `\abcd`\eh  -Jfgh%ij%~  < -  0klmn  \Z+@op  -qrxs   t%uvwxy \@op?lz{|}~B F+FG\_*_ -_ S0  - t% ++ $Oh]#$%l `vF - %? & j  " ,&       % $O    g% #$%&l sv!!!$O" "" %$O# ## %$*  %  & ]%' ( ) +F* + [\qr%Y, - . /  %+F0 S1 %2      3    S4    S5    S6  %7 77 -888 $OY [\[ 9qr  !::::"9#$%&'+()*+:,;-<<<<./0% T 1 2()3456789:=>;;;;<<<=:>:,> ? @9A BCDE F>G:H:I J KL?MN%@OPDQRST%UVA WXpYZ[%B\]Z%C^_D]^_.E`abcdeFfghiGHjIJ klmnOopqrK s tL _ZpumJvwxyM7Ez{N|}~%OP OOO; @PQ.X%  mX+%2IQRA_ TR% S@%T@UV T=TST)m%Q_Wp " ]^\9mjYWX  ?2?   $O0 %W VUX Y Y 1    Cl   9   *      }{"Z    ! " # $ % & ' ( ) * + ], - . / 0 1 2 %F|Z3 4 5 6 ]7 8 [9 \\\[: ; < ]]] = > ^ ^^ ]? < @ ^A  mB C D ENDB